Product details for  a disintegrin and metalloproteinase domain 9 (meltrin gam...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

a disintegrin and metalloproteinase domain 9 (meltrin gamma) (ADAM9) (Human) antibody

Overview

Image for a disintegrin and metalloproteinase domain 9 (meltrin gamma) (ADAM9) (Human) antibody
Antigen: A disintegrin and metalloproteinase domain 9 (meltrin gamma) (ADAM9)
Antibody Type: Monoclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN167925
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  a disintegrin and metalloproteinase domain 9 (meltrin gamma) (ADAM9) (Human) antibody

back to top ^


Antigen A disintegrin and metalloproteinase domain 9 (meltrin gamma) (ADAM9)
Gene ID 8754
Immunogen ADAM9 (NP_003807, 36 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) QTSHLSSYEIITPWRLTRERREAPRPYSKQVSYVIQAEGKEHIIHLERNKDLLPE DFVVYTYNKEGTLITDHPNIQNHCHYRGYVEGVHNSSIALSDCFG*
Reactivity Human
Antibody Type Monoclonal
Isotype IgG1 Kappa »Matching secondary antibodies
Description ADAM metallopeptidase domain 9 (meltrin gamma) This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. The protein encoded by this gene interacts with SH3 domain-containing proteins, binds mitotic arrest deficient 2 beta protein, and is also involved in TPA-induced ectodomain shedding of membrane-anchored heparin-binding EGF-like growth factor. Two alternative splice variants have been identified, encoding distinct isoforms. Mouse monoclonal antibody raised against a partial recombinant ADAM9. Synonyms: KIAA0021, MCMP, MDC9, Mltng
Clone 3000000
Host Mouse

Application Details:  a disintegrin and metalloproteinase domain 9 (meltrin gamma) (ADAM9) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  a disintegrin and metalloproteinase domain 9 (meltrin gamma) (ADAM9) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for a disintegrin and metalloproteinase domain 9 (meltrin gamma) (ADAM9) (Human) antibody (1)

The detection limit for recombinant GST tagged ADAM9 is approximately 0.3ng/ml as a capture antibody.

Image for a disintegrin and metalloproteinase domain 9 (meltrin gamma) (ADAM9) (Human) antibody (2)

External Information:  a disintegrin and metalloproteinase domain 9 (meltrin gamma) (ADAM9) (Human) antibody

back to top ^


Google Scholar Find more references for clone 3000000 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen ADAM9 (Bioinformatic Harvester (EMBL))