Product details for  a disintegrin-like and metalloprotease (reprolysin type) ...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7 (ADAMTS7) (Human) antibody

Overview

Image for a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7 (ADAMTS7) (Human) antibody
Antigen: A disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7 (ADAMTS7)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10 dry ice fee and VAT)
Order number: ABIN172142
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague

Additional Information:  a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7 (ADAMTS7) (Human) antibody

back to top ^


Antigen A disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7 (ADAMTS7)
Gene ID 11173
Immunogen ADAMTS7 (NP_055087, 1589 a.a. ~ 1687 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) VQRRLVKCVNTQTGLPEEDSDQCGHEAWPESSRPCGTEDCEPVEPPRCERDRLSF GFCETLRLLGRCQLPTIRTQCCRSCSPPSHGAPSRGHQRVARR*
Reactivity Human
Antibody Type Polyclonal
Description ADAM metallopeptidase with thrombospondin type 1 motif, 7 The protein encoded by this gene is a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) family. Members of this family share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene contains two C-terminal TS motifs. Mouse polyclonal antibody raised against a partial recombinant ADAMTS7. Synonyms: ADAM-TS7, DKFZp434H204
Host Mouse

Application Details:  a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7 (ADAMTS7) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (36.89 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7 (ADAMTS7) (Human) antibody

back to top ^


Western Blot detection against Immunogen (36.89 KDa) .

Image for a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7 (ADAMTS7) (Human) antibody (1)

External Information:  a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 7 (ADAMTS7) (Human) antibody

back to top ^


Google Scholar Find more references for antigen ADAMTS7 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen ADAMTS7 (Bioinformatic Harvester (EMBL))