You are here: Homepage » Product details for "aarF domain containing kinase 4 ADCK4 Human"

Product details for aarF domain containing kinase 4 (ADCK4) (Human) antibody

Print Version

aarF domain containing kinase 4 (ADCK4) (Human) antibody

Overview


	Antigen:	AarF domain containing kinase 4 (ADCK4)
	Antibody Type:	Monoclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	100 µg
	Price:	396,00 € (Plus shipping costs , €10 dry ice fee and VAT)
	Order number:	ABIN169379
	Availability:	Delivery in 7 to 10 days

Antigen	AarF domain containing kinase 4 (ADCK4)
Gene ID	79934
Immunogen	ADCK4 (AAH13114, 445 a.a. ~ 545 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) LGEPFATQGPYDFGSGETARRIQDLIPVLLRHRLCPPPEETYALHRKLAGAFLAC AHLRAHIACRDLFQDTYHRYWASRQPDAATAGSLPTKGDSWVDPS*
Reactivity	Human
Antibody Type	Monoclonal
Isotype	IgG2b Kappa »Matching secondary antibodies
Description	AarF domain containing kinase 4 Mouse monoclonal antibody raised against a partial recombinant ADCK4. Synonyms: FLJ12229
Clone	1D9
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (36.74 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (36.74 KDa) .

Image for aarF domain containing kinase 4 (ADCK4) (Human) antibody (1)

Google Scholar	Find more references for clone 1D9 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen ADCK4 (Bioinformatic Harvester (EMBL))