BASKET
HELP
Product details for adenosine kinase (ADK) (Human) antibody
adenosine kinase (ADK) (Human) antibody
Overview
|
|
| Antigen: | Adenosine kinase (ADK) |
| Antibody Type: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN169746 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: adenosine kinase (ADK) (Human) antibody
| Antigen | Adenosine kinase (ADK) |
| Gene ID | 132 |
| Immunogen | ADK (NP_001114, 236 a.a. ~ 346 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) FETKDIKEIAKKTQALPKMNSKRQRIVIFTQGRDDTIMATESEVTAFAVLDQDQK EIIDTNGAGDAFVGGFLSQLVSDKPLTECIRAGHYAASIIIRRTGCTFPEKPDFH * |
| Reactivity | Human |
| Antibody Type | Polyclonal |
| Description | Adenosine kinase This gene encodes adenosine kinase, an abundant enzyme in mammalian tissues. The enzyme catalyzes the transfer of the gamma-phosphate from ATP to adenosine, thereby serving as a regulator of concentrations of both extracellular adenosine and intracellular adenine nucleotides. Adenosine has widespread effects on the cardiovascular, nervous, respiratory, and immune systems and inhibitors of the enzyme could play an important pharmacological role in increasing intravascular adenosine concentrations and acting as anti-inflammatory agents. Alternative splicing results in two transcript variants encoding different isoforms. Both isoforms of the enzyme phosphorylate adenosine with identical kinetics and both require Mg2+ for activity. Mouse polyclonal antibody raised against a partial recombinant ADK. Synonyms: AK |
| Host | Mouse |
Application Details: adenosine kinase (ADK) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (38.21 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: adenosine kinase (ADK) (Human) antibody
|
Western Blot detection against Immunogen (38.21 KDa) . |
External Information: adenosine kinase (ADK) (Human) antibody
| Google Scholar | Find more references for antigen ADK on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen ADK (Bioinformatic Harvester (EMBL)) |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
