Product details for  adenosine monophosphate deaminase 2 (isoform L) (AMPD2) (...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

adenosine monophosphate deaminase 2 (isoform L) (AMPD2) (Human) antibody

Overview

Image for adenosine monophosphate deaminase 2 (isoform L) (AMPD2) (Human) antibody
Antigen: Adenosine monophosphate deaminase 2 (isoform L) (AMPD2)
Antibody Type: Monoclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human, Mouse (Murine), Rat
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN165618
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  adenosine monophosphate deaminase 2 (isoform L) (AMPD2) (Human) antibody

back to top ^


Antigen Adenosine monophosphate deaminase 2 (isoform L) (AMPD2)
Gene ID 271
Immunogen AMPD2 (NP_631895, 86 a.a. ~ 186 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) ISQDVKLEPDILLRAKQDFLKTDSDSDLQLYKEQGEGQGDRSLRERDVLEREFQR VTISGEEKCGVPFTDLLDAAKSVVRALFIREKYMALSLQSFCPTT*
Reactivity Human, Mouse (Murine), Rat
Antibody Type Monoclonal
Isotype IgG1 Kappa »Matching secondary antibodies
Description Adenosine monophosphate deaminase 2 (isoform L) Mouse monoclonal antibody raised against a partial recombinant AMPD2.
Clone 2F5
Host Mouse

Application Details:  adenosine monophosphate deaminase 2 (isoform L) (AMPD2) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  adenosine monophosphate deaminase 2 (isoform L) (AMPD2) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for adenosine monophosphate deaminase 2 (isoform L) (AMPD2) (Human) antibody (1)

External Information:  adenosine monophosphate deaminase 2 (isoform L) (AMPD2) (Human) antibody

back to top ^


Google Scholar Find more references for clone 2F5 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen AMPD2 (Bioinformatic Harvester (EMBL))