BASKET
HELP
Product details for alpha thalassemia/mental retardation syndrome X-linked (R...
alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae) (ATRX) (Human) antibody
Overview
|
|
| Antigen: | Alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae) (ATRX) |
| Antibody Type: | Monoclonal |
| Application: | ELISA, Western Blotting (WB) |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN165719 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae) (ATRX) (Human) antibody
| Antigen | Alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae) (ATRX) |
| Gene ID | 546 |
| Immunogen | ATRX (NP_000480, 2311 a.a. ~ 2411 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) FNLGALSAMSNQQLEDLINQGREKVVEATNSVTAVRIQPLEDIISAVWKENMNLS EAQVQALALSRQASQELDVKRREAIYNDVLTKQQMLISCVQRILM* |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG1 Kappa »Matching secondary antibodies |
| Description | Alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae) The protein encoded by this gene contains an ATPase/helicase domain, and thus it belongs to the SWI/SNF family of chromatin remodeling proteins. The mutations of this gene are associated with an X-linked mental retardation (XLMR) syndrome most often accompanied by alpha-thalassemia (ATRX) syndrome. Theses mutations have been shown to cause diverse changes in the pattern of DNA methylation, which may provide a link between chromatin remodeling, DNA methylation, and gene expression in developmental processes. This protein is found to undergo cell cycle-dependent phosphorylation, which regulates its nuclear matrix and chromatin association, and suggests its involvement in the gene regulation at interphase and chromosomal segregation in mitosis. Three alternatively spliced transcript variants encoding distinct isoforms have been reported. Mouse monoclonal antibody raised against a partial recombinant ATRX. Synonyms: ATR2, MGC2094, MRXS3, RAD54, RAD54L, SHS, XH2, XNP, ZNF-HX |
| Clone | 3C9 |
| Host | Mouse |
Application Details: alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae) (ATRX) (Human) antibody
| Application | ELISA, Western Blotting (WB) |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.99 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S. cerevisiae) (ATRX) (Human) antibody
|
Western Blot detection against Immunogen (37.99 KDa) .
The detection limit for recombinant GST tagged ATRX is approximately 0.1ng/ml as a capture antibody. |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
