Product details for  armadillo repeat containing, X-linked 2 (ARMCX2) (Human) ...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

armadillo repeat containing, X-linked 2 (ARMCX2) (Human) antibody

Overview

Image for armadillo repeat containing, X-linked 2 (ARMCX2) (Human) antibody
Antigen: Armadillo repeat containing, X-linked 2 (ARMCX2)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN171830
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  armadillo repeat containing, X-linked 2 (ARMCX2) (Human) antibody

back to top ^


Antigen Armadillo repeat containing, X-linked 2 (ARMCX2)
Gene ID 9823
Immunogen ARMCX2 (NP_055597, 508 a.a. ~ 600 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) NSIANFFRLLSQGGGKIKVEILKILSNFAENPDMLKKLLSTQVPASFSSLYNSYV ESEILINALTLFEIIYDNLRAEVFNYREFNKGSLFYL*
Reactivity Human
Antibody Type Polyclonal
Description Armadillo repeat containing, X-linked 2 This gene encodes a member of the ALEX family of proteins and may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members, including ALEX1 and ALEX3, on the X chromosome. Two alternative transcripts that encode the same protein but differ in the 5' UTR have been described. Additional alternative transcripts may exist but their full length natures have not been determined. A pseudogene for this locus is located on chromosome 7. Mouse polyclonal antibody raised against a partial recombinant ARMCX2. Synonyms: ALEX2, KIAA0512, MGC13343, MGC8742
Host Mouse

Application Details:  armadillo repeat containing, X-linked 2 (ARMCX2) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (36.23 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  armadillo repeat containing, X-linked 2 (ARMCX2) (Human) antibody

back to top ^


Western Blot detection against Immunogen (36.23 KDa) .

Image for armadillo repeat containing, X-linked 2 (ARMCX2) (Human) antibody (1)

External Information:  armadillo repeat containing, X-linked 2 (ARMCX2) (Human) antibody

back to top ^


Google Scholar Find more references for antigen ARMCX2 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen ARMCX2 (Bioinformatic Harvester (EMBL))