Product details for  armadillo repeat containing, X-linked 3 (ARMCX3) (Human) ...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

armadillo repeat containing, X-linked 3 (ARMCX3) (Human) antibody

Overview

Image for armadillo repeat containing, X-linked 3 (ARMCX3) (Human) antibody
Antigen: Armadillo repeat containing, X-linked 3 (ARMCX3)
Antibody Type: Monoclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN168947
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  armadillo repeat containing, X-linked 3 (ARMCX3) (Human) antibody

back to top ^


Antigen Armadillo repeat containing, X-linked 3 (ARMCX3)
Gene ID 51566
Immunogen ARMCX3 (NP_057691, 278 a.a. ~ 380 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) RELLRAQVPSSLGSLFNKKENKEVILKLLVIFENINDNFKWEENEPTQNQFGEGS LFFFLKEFQVCADKVLGIESHHDFLVKVKVGKFMAKLAEHMFPKSQE*
Reactivity Human
Antibody Type Monoclonal
Isotype IgG2a Kappa »Matching secondary antibodies
Description Armadillo repeat containing, X-linked 3 This gene encodes a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis. This gene is closely localized with other family members on the X chromosome. Three transcript variants encoding the same protein have been identified for this gene. Mouse monoclonal antibody raised against a partial recombinant ARMCX3. Synonyms: ALEX3, DKFZp781N1954, KIAA0443, MGC12199, dJ545K15.2
Clone 2G3
Host Mouse

Application Details:  armadillo repeat containing, X-linked 3 (ARMCX3) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.33 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  armadillo repeat containing, X-linked 3 (ARMCX3) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.33 KDa) .

Image for armadillo repeat containing, X-linked 3 (ARMCX3) (Human) antibody (1)

The detection limit for recombinant GST tagged ARMCX3 is approximately 0.1ng/ml as a capture antibody.

Image for armadillo repeat containing, X-linked 3 (ARMCX3) (Human) antibody (2)

External Information:  armadillo repeat containing, X-linked 3 (ARMCX3) (Human) antibody

back to top ^


Google Scholar Find more references for clone 2G3 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen ARMCX3 (Bioinformatic Harvester (EMBL))