Product details for  armadillo repeat gene deletes in velocardiofacial syndrom...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

armadillo repeat gene deletes in velocardiofacial syndrome (ARVCF) (Human) antibody

Overview

Image for armadillo repeat gene deletes in velocardiofacial syndrome (ARVCF) (Human) antibody
Antigen: Armadillo repeat gene deletes in velocardiofacial syndrome (ARVCF)
Antibody Type: Monoclonal
Application: Western Blotting (WB), Immunohistochemistry (IHC), ELISA
Reactivity: Human
Host: Mouse
Quantity: 100 µg
Price: 396,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN165677
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  armadillo repeat gene deletes in velocardiofacial syndrome (ARVCF) (Human) antibody

back to top ^


Antigen Armadillo repeat gene deletes in velocardiofacial syndrome (ARVCF)
Gene ID 421
Immunogen ARVCF (NP_001661, 863 a.a. ~ 963 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) LSPGGFDDSTLPLVDKSLEGEKTGSRDVIPMDALGPDGYSTVDRRERRPRGASSA GEASEKEPLKLDPSRKAPPPGPSRPAVRLVDAVGDAKPQPVDSWV*
Reactivity Human
Antibody Type Monoclonal
Isotype IgG1 Kappa »Matching secondary antibodies
Description Armadillo repeat gene deletes in velocardiofacial syndrome Armadillo Repeat gene deleted in Velo-Cardio-Facial syndrome (ARVCF) is a member of the catenin family which play an important role in the formation of adherens junction complexes, which are thought to facilitate communication between the inside and outside environments of a cell. ARVCF gene was isolated in the search for the genetic defect responsible for the autosomal dominant Velo-Cardio-Facial syndrome (VCFS) a relatively common human disorder with phenotypic features including cleft palate, conotruncal heart defects and facial dysmorphology. ARVCF gene encodes a protein containing two motifs, a coiled coil domain in the N-terminus and a 10 armadillo repeat sequence in the midregion. Since these sequences can facilitate protein-protein interactions ARVCF is thought to function in a protein complex. In addition, ARVCF contains a predicted nuclear-targeting sequence suggesting that it may have a function as a nuclear protein. Mouse monoclonal antibody raised against a partial recombinant ARVCF. Synonyms: FLJ35345
Clone 5D2
Host Mouse

Application Details:  armadillo repeat gene deletes in velocardiofacial syndrome (ARVCF) (Human) antibody

back to top ^


Application Western Blotting (WB), Immunohistochemistry (IHC), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 1x PBS, pH 7.2 Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  armadillo repeat gene deletes in velocardiofacial syndrome (ARVCF) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for armadillo repeat gene deletes in velocardiofacial syndrome (ARVCF) (Human) antibody (1)

Immunoperoxidase of monoclonal antibody to ARVCF (H00000421-M01) on formalin-fixed paraffin-embedded human stomach. [antibody concentration 3 ug/ml]

Image for armadillo repeat gene deletes in velocardiofacial syndrome (ARVCF) (Human) antibody (2)

External Information:  armadillo repeat gene deletes in velocardiofacial syndrome (ARVCF) (Human) antibody

back to top ^


Google Scholar Find more references for clone 5D2 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen ARVCF (Bioinformatic Harvester (EMBL))