Product details for arrestin, beta 2 (ARRB2) (Human) antibody
arrestin, beta 2 (ARRB2) (Human) antibody
Overview
|
|
| Antigen: | Arrestin, beta 2 (ARRB2) |
| Antibody Type: | Monoclonal |
| Application: | Immunohistochemistry (IHC), ELISA, Western Blotting (WB) |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN165674 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: arrestin, beta 2 (ARRB2) (Human) antibody
| Antigen | Arrestin, beta 2 (ARRB2) |
| Gene ID | 409 |
| Immunogen | ARRB2 (AAH07427, 300 a.a. ~ 410 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) NLASSTIVKEGANKEVLGILVSYRVKVKLVVSRGGDVSVELPFVLMHPKPHDHIP LPRPQSAAPETDVPVDTNLIEFDTNYATDDDIVFEDFARLRLKGMKDDDYDDQLC * |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG2a Kappa »Matching secondary antibodies |
| Description | Arrestin, beta 2 Members of arrestin/beta-arrestin protein family are thought to participate in agonist-mediated desensitization of G-protein-coupled receptors and cause specific dampening of cellular responses to stimuli such as hormones, neurotransmitters, or sensory signals. Arrestin beta 2, like arrestin beta 1, was shown to inhibit beta-adrenergic receptor function in vitro. It is expressed at high levels in the central nervous system and may play a role in the regulation of synaptic receptors. Besides the brain, a cDNA for arrestin beta 2 was isolated from thyroid gland, and thus it may also be involved in hormone-specific desensitization of TSH receptors. Multiple alternatively spliced transcript variants have been found for this gene, but the full-length nature of some variants has not been defined. Mouse monoclonal antibody raised against a partial recombinant ARRB2. Synonyms: ARB2, ARR2, DKFZp686L0365 |
| Clone | 3G1 |
| Host | Mouse |
Application Details: arrestin, beta 2 (ARRB2) (Human) antibody
| Application | Immunohistochemistry (IHC), ELISA, Western Blotting (WB) |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (35.21 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: arrestin, beta 2 (ARRB2) (Human) antibody
|
Western Blot detection against Immunogen (35.21 KDa) .
Immunoperoxidase of monoclonal antibody to ARRB2 (H00000409-M01) on formalin-fixed paraffin-embedded human tonsil. [antibody concentration 3ug/ml]
The detection limit for recombinant GST tagged ARRB2 is approximately 0.03ng/ml as a capture antibody. |








