Product details for  chloride channel 5 (nephrolithiasis 2, X-linked, Dent dis...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease) (CLCN5) (Human) antibody

Overview

Image for chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease) (CLCN5) (Human) antibody
Antigen: Chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease) (CLCN5)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN170011
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease) (CLCN5) (Human) antibody

back to top ^


Antigen Chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease) (CLCN5)
Gene ID 1184
Immunogen CLCN5 (NP_000075, 566 a.a. ~ 666 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) GYPFLEAKEEFAHKTLAMDVMKPRRNDPLLTVLTQDSMTVEDVETIISETTYSGF PVVVSRESQRLVGFVLRRDLIISIENARKKQDGVVSTSIIYFTEH*
Reactivity Human
Antibody Type Polyclonal
Description Chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease) CLCN5 is a voltage-gated chloride channel. Mutation of this gene results in Dent disease and renal tubular disorders complicated by nephrolithiasis. Mouse polyclonal antibody raised against a partial recombinant CLCN5. Synonyms: CLC5, CLCK2, DENTS, NPHL2, XLRH, XRN, hCIC-K2, hClC-K2
Host Mouse

Application Details:  chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease) (CLCN5) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease) (CLCN5) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease) (CLCN5) (Human) antibody (1)

External Information:  chloride channel 5 (nephrolithiasis 2, X-linked, Dent disease) (CLCN5) (Human) antibody

back to top ^


Google Scholar Find more references for antigen CLCN5 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen CLCN5 (Bioinformatic Harvester (EMBL))