Product details for  copine IV (CPNE4) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

copine IV (CPNE4) (Human) antibody

Overview

Image for copine IV (CPNE4) (Human) antibody
Antigen: Copine IV (CPNE4)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN173135
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  copine IV (CPNE4) (Human) antibody

back to top ^


Antigen Copine IV (CPNE4)
Gene ID 131034
Immunogen CPNE4 (NP_570720, 11 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) AANTLGIFNSPCLTKVELRVACKGISDRDALSKPDPCVILKMQSHGQWFEVDRTE VIRTCINPVYSKLFTVDFYFEEVQRLRFEVHDISSNHNGLKEAD*
Reactivity Human
Antibody Type Polyclonal
Description Copine IV Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. Mouse polyclonal antibody raised against a partial recombinant CPNE4. Synonyms: COPN4, CPN4, MGC15604
Host Mouse

Application Details:  copine IV (CPNE4) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.00 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  copine IV (CPNE4) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.00 KDa) .

Image for copine IV (CPNE4) (Human) antibody (1)

External Information:  copine IV (CPNE4) (Human) antibody

back to top ^


Google Scholar Find more references for antigen CPNE4 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen CPNE4 (Bioinformatic Harvester (EMBL))