Product details for copine V (CPNE5) (Human) antibody
copine V (CPNE5) (Human) antibody
Overview
|
|
| Antigen: | Copine V (CPNE5) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN169224 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: copine V (CPNE5) (Human) antibody
| Antigen | Copine V (CPNE5) |
| Gene ID | 57699 |
| Immunogen | CPNE5 (NP_065990, 393 a.a. ~ 451 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) RVSHEFPLNGNQENPSCCGIDGILEAYHRSLRTVQLYGPTNFAPVVTHVARNAAA VQD* |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG1 Kappa »Matching secondary antibodies |
| Description | Copine V Calcium-dependent membrane-binding proteins may regulate molecular events at the interface of the cell membrane and cytoplasm. This gene is one of several genes that encode a calcium-dependent protein containing two N-terminal type II C2 domains and an integrin A domain-like sequence in the C-terminus. Sequence analysis identified multiple alternatively spliced transcript variants but their full-length natures could not be determined. Mouse monoclonal antibody raised against a partial recombinant CPNE5. Synonyms: COPN5, CPN5, DKFZp666C234, KIAA1599 |
| Clone | 2G4 |
| Host | Mouse |
Application Details: copine V (CPNE5) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (32.49 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: copine V (CPNE5) (Human) antibody
|
Western Blot detection against Immunogen (32.49 KDa) . |








