Product details for  copine VII (CPNE7) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

copine VII (CPNE7) (Human) antibody

Overview

Image for copine VII (CPNE7) (Human) antibody
Antigen: Copine VII (CPNE7)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN172402
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  copine VII (CPNE7) (Human) antibody

back to top ^


Antigen Copine VII (CPNE7)
Gene ID 27132
Immunogen CPNE7 (NP_705900, 460 a.a. ~ 559 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) ASRLPMSIIIVGVGNADFTDMQVLDGDDGVLRSPRGEPALRDIVQFVPFRELKNA SPAALAKCVLAEVPKQVVEYYSHRGLPPRSLGVPAGEASPGCTP*
Reactivity Human
Antibody Type Polyclonal
Description Copine VII This gene encodes a member of the copine family, which is composed of calcium-dependent membrane-binding proteins. The gene product contains two N-terminal C2 domains and one von Willebrand factor A domain. Sequence analysis identified two alternatively spliced transcript variants that encode different isoforms. Mouse polyclonal antibody raised against a partial recombinant CPNE7. Synonyms: MGC34192
Host Mouse

Application Details:  copine VII (CPNE7) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.00 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  copine VII (CPNE7) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.00 KDa) .

Image for copine VII (CPNE7) (Human) antibody (1)

External Information:  copine VII (CPNE7) (Human) antibody

back to top ^


Google Scholar Find more references for antigen CPNE7 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen CPNE7 (Bioinformatic Harvester (EMBL))