Product details for  copper chaperone for superoxide dismutase (CCS) (Human) a...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

copper chaperone for superoxide dismutase (CCS) (Human) antibody

Overview

Image for copper chaperone for superoxide dismutase (CCS) (Human) antibody
Antigen: Copper chaperone for superoxide dismutase (CCS)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN171854
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  copper chaperone for superoxide dismutase (CCS) (Human) antibody

back to top ^


Antigen Copper chaperone for superoxide dismutase (CCS)
Gene ID 9973
Immunogen CCS (NP_005116, 175 a.a. ~ 275 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) ADGRAIFRMEDEQLKVWDVIGRSLIIDEGEDDLGRGGHPLSKITGNSGERLACGI IARSAGLFQNPKQICSCDGLTIWEERGRPIAGKGRKESAQPPAHL*
Reactivity Human
Antibody Type Polyclonal
Description Copper chaperone for superoxide dismutase Copper chaperone for superoxide dismutase specifically delivers Cu to copper/zinc superoxide dismutase and may activate copper/zinc superoxide dismutase through direct insertion of the Cu cofactor. Mouse polyclonal antibody raised against a partial recombinant CCS. Synonyms: MGC138260
Host Mouse

Application Details:  copper chaperone for superoxide dismutase (CCS) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  copper chaperone for superoxide dismutase (CCS) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for copper chaperone for superoxide dismutase (CCS) (Human) antibody (1)

External Information:  copper chaperone for superoxide dismutase (CCS) (Human) antibody

back to top ^


Google Scholar Find more references for antigen CCS on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen CCS (Bioinformatic Harvester (EMBL))