Product details for  diazepam binding inhibitor (GABA receptor modulator, acyl...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) (DBI) (Human) antibody

Overview

Image for diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) (DBI) (Human) antibody
Antigen: Diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) (DBI)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN170103
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) (DBI) (Human) antibody

back to top ^


Antigen Diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) (DBI)
Gene ID 1622
Immunogen DBI (NP_065438, 1 a.a. ~ 105 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVG DINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI*
Reactivity Human
Antibody Type Polyclonal
Description Diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) Mouse polyclonal antibody raised against a partial recombinant DBI. Synonyms: ACBD1, ACBP, MGC70414
Host Mouse

Application Details:  diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) (DBI) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.55 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) (DBI) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.55 KDa) .

Image for diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) (DBI) (Human) antibody (1)

External Information:  diazepam binding inhibitor (GABA receptor modulator, acyl-Coenzyme A binding protein) (DBI) (Human) antibody

back to top ^


Google Scholar Find more references for antigen DBI on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen DBI (Bioinformatic Harvester (EMBL))