Product details for  dihydrolipoamide S-succinyltransferase (E2 component of 2...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (DLST) (Human) antibody

Overview

Image for dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (DLST) (Human) antibody
Antigen: Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (DLST)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN170124
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (DLST) (Human) antibody

back to top ^


Antigen Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (DLST)
Gene ID 1743
Immunogen DLST (NP_001924, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MLSRSRCVSRAFSRSLSAFQKGNCPLGRRSLPGVSLCQGPGYPNSRKVVINNSVF SVRFFRTTAVCKDDLVTVKTPAFAESVTEGDVRWEKAVGDTVAE*
Reactivity Human
Antibody Type Polyclonal
Description Dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) Mouse polyclonal antibody raised against a partial recombinant DLST. Synonyms: DLTS
Host Mouse

Application Details:  dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (DLST) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.00 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (DLST) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.00 KDa) .

Image for dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (DLST) (Human) antibody (1)

External Information:  dihydrolipoamide S-succinyltransferase (E2 component of 2-oxo-glutarate complex) (DLST) (Human) antibody

back to top ^


Google Scholar Find more references for antigen DLST on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen DLST (Bioinformatic Harvester (EMBL))