Product details for elastin microfibril interfacer 2 (EMILIN2) (Human) antibody
elastin microfibril interfacer 2 (EMILIN2) (Human) antibody
Overview
|
|
| Antigen: | Elastin microfibril interfacer 2 (EMILIN2) |
| Antibody Type: | Monoclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN169433 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: elastin microfibril interfacer 2 (EMILIN2) (Human) antibody
| Antigen | Elastin microfibril interfacer 2 (EMILIN2) |
| Gene ID | 84034 |
| Immunogen | EMILIN2 (NP_114437, 121 a.a. ~ 231 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) GPKDPVKTLRPTPARPRNSLKKATDNEPSQFSEPRKTLSPTGTAQPSWGVDPKEG PQELQEKKIQVLEEKVLRLTRTVLDLQSSLAGVSENLKHATQDDASRTRAPGLSS * |
| Reactivity | Human |
| Antibody Type | Monoclonal |
| Isotype | IgG3 Kappa »Matching secondary antibodies |
| Description | Elastin microfibril interfacer 2 Mouse monoclonal antibody raised against a partial recombinant EMILIN2. Synonyms: EMILIN-2, FLJ33200, FOAP-10 |
| Clone | 3D9 |
| Host | Mouse |
Application Details: elastin microfibril interfacer 2 (EMILIN2) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 1x PBS, pH 7.2 Western Blot detection against Immunogen (38.21 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: elastin microfibril interfacer 2 (EMILIN2) (Human) antibody
|
Western Blot detection against Immunogen (38.21 KDa) . |








