Product details for  general transcription factor IIIC, polypeptide 4, 90kDa (...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

general transcription factor IIIC, polypeptide 4, 90kDa (GTF3C4) (Human) antibody

Overview

Image for general transcription factor IIIC, polypeptide 4, 90kDa (GTF3C4) (Human) antibody
Antigen: General transcription factor IIIC, polypeptide 4, 90kDa (GTF3C4)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN171730
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  general transcription factor IIIC, polypeptide 4, 90kDa (GTF3C4) (Human) antibody

back to top ^


Antigen General transcription factor IIIC, polypeptide 4, 90kDa (GTF3C4)
Gene ID 9329
Immunogen GTF3C4 (NP_036336, 723 a.a. ~ 823 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) DDRTARVLIGHISKKMNKQTFPEHCSLCKEILPFTDRKQAVCSNGHIWLRCFLTY QSCQSLIYRRCLLHDSIARHPAPEDPDWIKRLLQSPCPFCDSPVF*
Reactivity Human
Antibody Type Polyclonal
Description General transcription factor IIIC, polypeptide 4, 90kDa Mouse polyclonal antibody raised against a partial recombinant GTF3C4. Synonyms: MGC138450, TFIII90, TFIIIC90, TFIIICdelta, TFiiiC2-90
Host Mouse

Application Details:  general transcription factor IIIC, polypeptide 4, 90kDa (GTF3C4) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  general transcription factor IIIC, polypeptide 4, 90kDa (GTF3C4) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for general transcription factor IIIC, polypeptide 4, 90kDa (GTF3C4) (Human) antibody (1)

External Information:  general transcription factor IIIC, polypeptide 4, 90kDa (GTF3C4) (Human) antibody

back to top ^


Google Scholar Find more references for antigen GTF3C4 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen GTF3C4 (Bioinformatic Harvester (EMBL))