You are here: Homepage » Product details for "hematopoietic cellspecific Lyn substrate 1 HCLS1 Human"

Product details for hematopoietic cell-specific Lyn substrate 1 (HCLS1) (Huma...

Print Version

hematopoietic cell-specific Lyn substrate 1 (HCLS1) (Human) antibody

Overview


	Antigen:	Hematopoietic cell-specific Lyn substrate 1 (HCLS1)
	Antibody Type:	Monoclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	100 µg
	Price:	396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN166465
	Availability:	Delivery in 7 to 10 days

Antigen	Hematopoietic cell-specific Lyn substrate 1 (HCLS1)
Gene ID	3059
Immunogen	HCLS1 (AAH16758, 266 a.a. ~ 356 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTS REHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE*
Reactivity	Human
Antibody Type	Monoclonal
Isotype	IgG1 Kappa »Matching secondary antibodies
Description	Hematopoietic cell-specific Lyn substrate 1 Mouse monoclonal antibody raised against a partial recombinant HCLS1. Synonyms: HS1
Clone	3D5
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein on ELISA
Buffer	In 1x PBS, pH 7.2
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

HCLS1 monoclonal antibody (M01), clone 3D5. Western Blot analysis of HCLS1 expression in K-562 ( Cat # L009V1 ).

Image for hematopoietic cell-specific Lyn substrate 1 (HCLS1) (Human) antibody (1)

Google Scholar	Find more references for clone 3D5 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen HCLS1 (Bioinformatic Harvester (EMBL))