Product details for  immunoglobulin superfamily, member 10 (IGSF10) (Human) an...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

immunoglobulin superfamily, member 10 (IGSF10) (Human) antibody

Overview

Image for immunoglobulin superfamily, member 10 (IGSF10) (Human) antibody
Antigen: Immunoglobulin superfamily, member 10 (IGSF10)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN173251
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  immunoglobulin superfamily, member 10 (IGSF10) (Human) antibody

back to top ^


Antigen Immunoglobulin superfamily, member 10 (IGSF10)
Gene ID 285313
Immunogen IGSF10 (NP_849144, 301 a.a. ~ 400 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) SAFISPQGFMAPFGSLTLNMTDQSGNEANMVCSIQKPSRTSPIAFTEENDYIVLN TSFSTFLVCNIDYGHIQPVWQILALYSDSPLILERSHLLSETPQ*
Reactivity Human
Antibody Type Polyclonal
Description Immunoglobulin superfamily, member 10 Mouse polyclonal antibody raised against a partial recombinant IGSF10. Synonyms: CMF608, FLJ25972
Host Mouse

Application Details:  immunoglobulin superfamily, member 10 (IGSF10) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.00 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  immunoglobulin superfamily, member 10 (IGSF10) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.00 KDa) .

Image for immunoglobulin superfamily, member 10 (IGSF10) (Human) antibody (1)

External Information:  immunoglobulin superfamily, member 10 (IGSF10) (Human) antibody

back to top ^


Google Scholar Find more references for antigen IGSF10 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen IGSF10 (Bioinformatic Harvester (EMBL))