You are here: Homepage » Product details for "jun dimerization protein 2 JDP2 Human"

Product details for jun dimerization protein 2 (JDP2) (Human) antibody

Print Version

jun dimerization protein 2 (JDP2) (Human) antibody

Overview


	Antigen:	Jun dimerization protein 2 (JDP2)
	Antibody Type:	Polyclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	50 µl
	Price:	258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN173115
	Availability:	Delivery in 7 to 10 days

Antigen	Jun dimerization protein 2 (JDP2)
Gene ID	122953
Immunogen	JDP2 (NP_569736, 83 a.a. ~ 164 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) KVAAARCRNKKKERTEFLQRESERLELMNAELKTQIEELKQERQQLILMLNRHRP TCIVRTDSVKTPESEGNPLLEQLEKK*
Reactivity	Human
Antibody Type	Polyclonal
Description	Jun dimerization protein 2 Mouse polyclonal antibody raised against a partial recombinant JDP2. Synonyms: JUNDM2
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 50% Glycerol Western Blot detection against Immunogen (35.02 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (35.02 KDa) .

Image for jun dimerization protein 2 (JDP2) (Human) antibody (1)

Google Scholar	Find more references for antigen JDP2 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen JDP2 (Bioinformatic Harvester (EMBL))