Product details for  killer cell lectin-like receptor subfamily A, member 1 (K...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

killer cell lectin-like receptor subfamily A, member 1 (KLRA1) (Human) antibody

Overview

Image for killer cell lectin-like receptor subfamily A, member 1 (KLRA1) (Human) antibody
Antigen: Killer cell lectin-like receptor subfamily A, member 1 (KLRA1)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN172053
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  killer cell lectin-like receptor subfamily A, member 1 (KLRA1) (Human) antibody

back to top ^


Antigen Killer cell lectin-like receptor subfamily A, member 1 (KLRA1)
Gene ID 10748
Immunogen KLRA1 (NP_006602, 66 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) VTNIFQCIQEKHQRQEILRNCSEKYIMQNDNYLKEQILTNKTLKYDVLKNSFQQK KELDSRLIQKNRCHRENEIVFKVLQNTGKFSEDHGSCCGVNCYYFTMQKKD*
Reactivity Human
Antibody Type Polyclonal
Description Killer cell lectin-like receptor subfamily A, member 1 Mouse polyclonal antibody raised against a partial recombinant KLRA1. Synonyms: KLRA#, LY49L, Ly-49L, Ly49, MGC126520, MGC126522
Host Mouse

Application Details:  killer cell lectin-like receptor subfamily A, member 1 (KLRA1) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.77 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  killer cell lectin-like receptor subfamily A, member 1 (KLRA1) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.77 KDa) .

Image for killer cell lectin-like receptor subfamily A, member 1 (KLRA1) (Human) antibody (1)

External Information:  killer cell lectin-like receptor subfamily A, member 1 (KLRA1) (Human) antibody

back to top ^


Google Scholar Find more references for antigen KLRA1 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen KLRA1 (Bioinformatic Harvester (EMBL))