Product details for  lectin, galactoside-binding, soluble, 4 (galectin 4) (LGA...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

lectin, galactoside-binding, soluble, 4 (galectin 4) (LGALS4) (Human) antibody

Overview

Image for lectin, galactoside-binding, soluble, 4 (galectin 4) (LGALS4) (Human) antibody
Antigen: Lectin, galactoside-binding, soluble, 4 (galectin 4) (LGALS4)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN170592
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  lectin, galactoside-binding, soluble, 4 (galectin 4) (LGALS4) (Human) antibody

back to top ^


Antigen Lectin, galactoside-binding, soluble, 4 (galectin 4) (LGALS4)
Gene ID 3960
Immunogen LGALS4 (NP_006140, 51 a.a. ~ 151 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) VVGQDPGSDVAFHFNPRFDGWDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVF IVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDGDLQLQSINFI*
Reactivity Human
Antibody Type Polyclonal
Description Lectin, galactoside-binding, soluble, 4 (galectin 4) The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS4 is an S-type lectin that is strongly underexpressed in colorectal cancer. The 323-amino acid LGALS4 protein contains 2 homologous, approximately 150-amino acid carbohydrate recognition domains and all amino acids typically conserved in galectins. Mouse polyclonal antibody raised against a partial recombinant LGALS4. Synonyms: GAL4
Host Mouse

Application Details:  lectin, galactoside-binding, soluble, 4 (galectin 4) (LGALS4) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  lectin, galactoside-binding, soluble, 4 (galectin 4) (LGALS4) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for lectin, galactoside-binding, soluble, 4 (galectin 4) (LGALS4) (Human) antibody (1)

External Information:  lectin, galactoside-binding, soluble, 4 (galectin 4) (LGALS4) (Human) antibody

back to top ^


Google Scholar Find more references for antigen LGALS4 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen LGALS4 (Bioinformatic Harvester (EMBL))