BASKET
HELP
Product details for lectin, galactoside-binding, soluble, 9 (galectin 9) (LGA...
lectin, galactoside-binding, soluble, 9 (galectin 9) (LGALS9) (Human) antibody
Overview
|
|
| Antigen: | Lectin, galactoside-binding, soluble, 9 (galectin 9) (LGALS9) |
| Antibody Type: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN170593 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: lectin, galactoside-binding, soluble, 9 (galectin 9) (LGALS9) (Human) antibody
| Antigen | Lectin, galactoside-binding, soluble, 9 (galectin 9) (LGALS9) |
| Gene ID | 3965 |
| Immunogen | LGALS9 (NP_033665, 254 a.a. ~ 356 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) FHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSV WILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT* |
| Reactivity | Human |
| Antibody Type | Polyclonal |
| Description | Lectin, galactoside-binding, soluble, 9 (galectin 9) The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The protein encoded by this gene is an S-type lectin. This galectin is strongly overexpressed in Hodgkin's disease tissue and it might participate in the interaction between the H&RS cells with their surrounding cells and might thus play a role in the pathogenesis of this disease and/or its consistently associated immunodeficiency. The protein has N- and C- terminal carbohydrate-binding domains connected by a link peptide. Multiple alternatively spliced transcript variants have been found for this gene. Mouse polyclonal antibody raised against a partial recombinant LGALS9. Synonyms: ECALECTIN, MGC117375, MGC125973, MGC125974, galectin-9 |
| Host | Mouse |
Application Details: lectin, galactoside-binding, soluble, 9 (galectin 9) (LGALS9) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (37.33 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Publications: lectin, galactoside-binding, soluble, 9 (galectin 9) (LGALS9) (Human) antibody
| Publications |
Bellac, Coimbra, Simon et al.: "Gene and protein expression of galectin-3 and galectin-9 in experimental pneumococcal meningitis." In: Neurobiology of disease , Vol. 28, Issue 2, pp. 175-83, 2007/01 (PubMed) |
Images: lectin, galactoside-binding, soluble, 9 (galectin 9) (LGALS9) (Human) antibody
|
Western Blot detection against Immunogen (37.33 KDa) . |
External Information: lectin, galactoside-binding, soluble, 9 (galectin 9) (LGALS9) (Human) antibody
| Google Scholar | Find more references for antigen LGALS9 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen LGALS9 (Bioinformatic Harvester (EMBL)) |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
