Product details for  mab-21-like 1 (C. elegans) (MAB21L1) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

mab-21-like 1 (C. elegans) (MAB21L1) (Human) antibody

Overview

Image for mab-21-like 1 (C. elegans) (MAB21L1) (Human) antibody
Antigen: Mab-21-like 1 (C. elegans) (MAB21L1)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10 dry ice fee and VAT)
Order number: ABIN170614
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague

Additional Information:  mab-21-like 1 (C. elegans) (MAB21L1) (Human) antibody

back to top ^


Antigen Mab-21-like 1 (C. elegans) (MAB21L1)
Gene ID 4081
Immunogen MAB21L1 (NP_005575, 250 a.a. ~ 359 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) CLSILKTLRDRHLELPGQPLNNYHMKTLVSYECEKHPRESDWDESCLGDRLNGIL LQLISCLQCRRCPHYFLPNLDLFQGKPHSALENAAKQTWRLAREILTNPKSLEK*
Reactivity Human
Antibody Type Polyclonal
Description Mab-21-like 1 (C. elegans) This gene is similar to the MAB-21 cell fate-determining gene found in C. elegans. It may be involved in eye and cerebellum development, and it has been proposed that expansion of a trinucleotide repeat region in the 5' UTR may play a role in a variety of psychiatric disorders. There is evidence that this gene has 2 transcripts with alternate polyA sites, but the full length nature of the longer transcript has not been defined. Mouse polyclonal antibody raised against a partial recombinant MAB21L1. Synonyms: CAGR1, FLJ10197, Nbla00126
Host Mouse

Application Details:  mab-21-like 1 (C. elegans) (MAB21L1) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (38.10 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  mab-21-like 1 (C. elegans) (MAB21L1) (Human) antibody

back to top ^


Western Blot detection against Immunogen (38.10 KDa) .

Image for mab-21-like 1 (C. elegans) (MAB21L1) (Human) antibody (1)

External Information:  mab-21-like 1 (C. elegans) (MAB21L1) (Human) antibody

back to top ^


Google Scholar Find more references for antigen MAB21L1 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen MAB21L1 (Bioinformatic Harvester (EMBL))