BASKET
HELP
Product details for multimerin 1 (MMRN1) (Human) antibody
multimerin 1 (MMRN1) (Human) antibody
Overview
|
|
| Antigen: | Multimerin 1 (MMRN1) |
| Antibody Type: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN172197 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: multimerin 1 (MMRN1) (Human) antibody
| Antigen | Multimerin 1 (MMRN1) |
| Gene ID | 22915 |
| Immunogen | MMRN1 (NP_031377, 291 a.a. ~ 391 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) IHTNQAESHTAVGRGVAEQQQQQGCGDPEVMQKMTDQVNYQAMKLTLLQKKIDNI SLTVNDVRNTYSSLEGKVSEDKSREFQSLLKGLKSKSINVLIRDI* |
| Reactivity | Human |
| Antibody Type | Polyclonal |
| Description | Multimerin 1 Multimerin is a massive, soluble protein found in platelets and in the endothelium of blood vessels. It is comprised of subunits linked by interchain disulfide bonds to form large, variably sized homomultimers. Multimerin is a factor V/Va-binding protein and may function as a carrier protein for platelet factor V. It may also have functions as an extracellular matrix or adhesive protein. Recently, patients with an unusual autosomal-dominant bleeding disorder (factor V Quebec) were found to have a deficiency of platelet multimerin. Mouse polyclonal antibody raised against a partial recombinant MMRN1. Synonyms: ECM, EMILIN4, GPIa*, MMRN |
| Host | Mouse |
Application Details: multimerin 1 (MMRN1) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: multimerin 1 (MMRN1) (Human) antibody
|
Western Blot detection against Immunogen (37.11 KDa) . |
External Information: multimerin 1 (MMRN1) (Human) antibody
| Google Scholar | Find more references for antigen MMRN1 on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen MMRN1 (Bioinformatic Harvester (EMBL)) |
browse antibodies by
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
Antigens
Secondary Antibodies
Research areas
Clones
Hosts
Applications
Reactivity
Supplier
