Product details for  neural precursor cell expressed, developmentally down-reg...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

neural precursor cell expressed, developmentally down-regulated 8 (NEDD8) (Human) antibody

Overview

Image for neural precursor cell expressed, developmentally down-regulated 8 (NEDD8) (Human) antibody
Antigen: Neural precursor cell expressed, developmentally down-regulated 8 (NEDD8)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN170720
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  neural precursor cell expressed, developmentally down-regulated 8 (NEDD8) (Human) antibody

back to top ^


Antigen Neural precursor cell expressed, developmentally down-regulated 8 (NEDD8)
Gene ID 4738
Immunogen NEDD8 (NP_006147, 1 a.a. ~ 82 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKT AADYKILGGSVLHLVLALRGGGGLRQ*
Reactivity Human
Antibody Type Polyclonal
Description Neural precursor cell expressed, developmentally down-regulated 8 Mouse polyclonal antibody raised against a partial recombinant NEDD8. Synonyms: MGC104393, MGC125896, MGC125897, Nedd-8
Host Mouse

Application Details:  neural precursor cell expressed, developmentally down-regulated 8 (NEDD8) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (35.02 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  neural precursor cell expressed, developmentally down-regulated 8 (NEDD8) (Human) antibody

back to top ^


Western Blot detection against Immunogen (35.02 KDa) .

Image for neural precursor cell expressed, developmentally down-regulated 8 (NEDD8) (Human) antibody (1)

External Information:  neural precursor cell expressed, developmentally down-regulated 8 (NEDD8) (Human) antibody

back to top ^


Google Scholar Find more references for antigen NEDD8 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen NEDD8 (Bioinformatic Harvester (EMBL))