You are here: Homepage » Product details for "neurofascin homolog chicken NFASC Human"

Product details for neurofascin homolog (chicken) (NFASC) (Human) antibody

Print Version

neurofascin homolog (chicken) (NFASC) (Human) antibody

Overview


	Antigen:	Neurofascin homolog (chicken) (NFASC)
	Antibody Type:	Polyclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human
	Host:	Mouse
	Quantity:	50 µl
	Price:	258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN172225
	Availability:	Delivery in 7 to 10 days

Antigen	Neurofascin homolog (chicken) (NFASC)
Gene ID	23114
Immunogen	NFASC (-, 661 a.a. ~ 759 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) KDDEPLYIGNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQ ATPTNRLAALPKGRPDRPRDLELTDLAERSVRLTWIPGDANNS*
Reactivity	Human
Antibody Type	Polyclonal
Description	Neurofascin homolog (chicken) Neurofascin is an L1 family immunoglobulin cell adhesion molecule (see L1CAM, MIM 308840) involved in axon subcellular targeting and synapse formation during neural development (Ango et al., 2004). Mouse polyclonal antibody raised against a partial recombinant NFASC. Synonyms: DKFZp686P2250, FLJ46866, KIAA0756, NF, NRCAML
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 50% Glycerol Western Blot detection against Immunogen (36.89 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (36.89 KDa) .

Image for neurofascin homolog (chicken) (NFASC) (Human) antibody (1)

Google Scholar	Find more references for antigen NFASC on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen NFASC (Bioinformatic Harvester (EMBL))