Product details for neurotrimin (HNT) (Human) antibody
neurotrimin (HNT) (Human) antibody
Overview
|
|
| Antigen: | Neurotrimin (HNT) |
| Antibody Type: | Polyclonal |
| Application: | Western Blotting (WB), ELISA |
| Reactivity: | Human |
| Host: | Mouse |
| Quantity: | |
| Price: | 258,00 € (Plus shipping costs , €10.00 dry ice fee and VAT) |
| Order number: | ABIN172476 |
| Availability: | Delivery in 7 to 10 days |
Additional Information: neurotrimin (HNT) (Human) antibody
| Antigen | Neurotrimin (HNT) |
| Gene ID | 50863 |
| Immunogen | HNT (NP_057606, 29 a.a. ~ 139 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) VPVRSGDATFPKAMDNVTVRQGESATLRCTIDNRVTRVAWLNRSTILYAGNDKWC LDPRVVLLSNTQTQYSIEIQNVDVYDEGPYTCSVQTDNHPKTSRVHLIVQVSPKI * |
| Reactivity | Human |
| Antibody Type | Polyclonal |
| Description | Neurotrimin This gene encodes a member of the IgLON (LAMP, OBCAM, Ntm) family of immunoglobulin (Ig) domain-containing glycosylphosphatidylinositol (GPI)-anchored cell adhesion molecules. The encoded protein may promote neurite outgrowth and adhesion via a homophilic mechanism. This gene is closely linked to a related family member, opioid binding protein/cell adhesion molecule-like (OPCML), on chromosome 11. Multiple alternatively spliced variants have been found but only two variants have had their full-length sequences determined. Mouse polyclonal antibody raised against a partial recombinant HNT. Synonyms: MGC60329, NTM |
| Host | Mouse |
Application Details: neurotrimin (HNT) (Human) antibody
| Application | Western Blotting (WB), ELISA |
| Application Notes | Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Buffer | In 50% Glycerol Western Blot detection against Immunogen (38.21 KDa) . |
| Storage | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Restrictions | For Research Use only |
Images: neurotrimin (HNT) (Human) antibody
|
Western Blot detection against Immunogen (38.21 KDa) . |
External Information: neurotrimin (HNT) (Human) antibody
| Google Scholar | Find more references for antigen HNT on Google Scholar™ |
| EMBL Harvester | Search human, mouse or rat genome for antigen HNT (Bioinformatic Harvester (EMBL)) |








