Product details for  neurotrophin 5 (neurotrophin 4/5) (NTF5) (Human) antibody
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

neurotrophin 5 (neurotrophin 4/5) (NTF5) (Human) antibody

Overview

Image for neurotrophin 5 (neurotrophin 4/5) (NTF5) (Human) antibody
Antigen: Neurotrophin 5 (neurotrophin 4/5) (NTF5)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN170768
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  neurotrophin 5 (neurotrophin 4/5) (NTF5) (Human) antibody

back to top ^


Antigen Neurotrophin 5 (neurotrophin 4/5) (NTF5)
Gene ID 4909
Immunogen NTF5 (NP_006170, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) VDLRGREVEVLGEVPAAGGSPLRQYFFETRCKADNAEEGGPGAGGGGCRGVDRRH WVSECKAKQSYVRALTADAQGRVGWRWIRIDTACVCTLLSRTGR*
Reactivity Human
Antibody Type Polyclonal
Description Neurotrophin 5 (neurotrophin 4/5) This gene is a member of a family of neurotrophic factors, neurotrophins, that control survival and differentiation of mammalian neurons. The expression of this gene is ubiquitous and less influenced by environmental signals. While knock-outs of other neurotrophins including nerve growth factor, brain-derived neurotrophic factor, and neurotrophin 3 prove lethal during early postnatal development, NTF5-deficient mice only show minor cellular deficits and develop normally to adulthood. Mouse polyclonal antibody raised against a partial recombinant NTF5. Synonyms: NT-4/5, NT4, NT5, NTF4
Host Mouse

Application Details:  neurotrophin 5 (neurotrophin 4/5) (NTF5) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.00 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  neurotrophin 5 (neurotrophin 4/5) (NTF5) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.00 KDa) .

Image for neurotrophin 5 (neurotrophin 4/5) (NTF5) (Human) antibody (1)

External Information:  neurotrophin 5 (neurotrophin 4/5) (NTF5) (Human) antibody

back to top ^


Google Scholar Find more references for antigen NTF5 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen NTF5 (Bioinformatic Harvester (EMBL))