ubiquilin 2 (UBQLN2) (Human) antibody

Overview


	Antigen:	Ubiquilin 2 (UBQLN2)
	Antibody Type:	Monoclonal
	Application:	Western Blotting (WB), ELISA
	Reactivity:	Human, Mouse (Murine), Rat
	Host:	Mouse
	Quantity:	100 µg
	Price:	396,00 € (Plus shipping costs , €10.00 dry ice fee and VAT)
	Order number:	ABIN168847
	Availability:	Delivery in 7 to 10 days

Antigen	Ubiquilin 2 (UBQLN2)
Gene ID	29978
Immunogen	UBQLN2 (NP_038472, 555 a.a. ~ 625 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) PNQQFIQQMVQALAGANAPQLPNPEVRFQQQLEQLNAMGFLNREANLQALIATGG DINAAIERLLGSQPS*
Reactivity	Human, Mouse (Murine), Rat
Antibody Type	Monoclonal
Isotype	IgG2a Kappa »Matching secondary antibodies
Description	Ubiquilin 2 This gene encodes an ubiquitin-like protein (ubiquilin) that shares high degree of similarity with related products in yeast, rat and frog. Ubiquilins contain a N-terminal ubiquitin-like domain and a C-terminal ubiquitin-associated domain. They physically associate with both proteasomes and ubiquitin ligases, and thus thought to functionally link the ubiquitination machinery to the proteasome to affect in vivo protein degradation. This ubiquilin has also been shown to bind the ATPase domain of the Hsp70-like Stch protein. Mouse monoclonal antibody raised against a partial recombinant UBQLN2. Synonyms: CHAP1, CHAP1/DSK2, Dsk2, HRIHFB2157, LIC-2, N4BP4, PLIC-2, PLIC2, RIHFB2157
Clone	5F5
Host	Mouse

Application	Western Blotting (WB), ELISA
Application Notes	Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer	In 1x PBS, pH 7.2 Western Blot detection against Immunogen (33.44 KDa) .
Storage	Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions	For Research Use only

Western Blot detection against Immunogen (33.44 KDa) .

Image for ubiquilin 2 (UBQLN2) (Human) antibody (1)

The detection limit for recombinant GST tagged UBQLN2 is approximately 0.03ng/ml as a capture antibody.

Image for ubiquilin 2 (UBQLN2) (Human) antibody (2)

Google Scholar	Find more references for clone 5F5 on Google Scholar™
EMBL Harvester	Search human, mouse or rat genome for antigen UBQLN2 (Bioinformatic Harvester (EMBL))