Product details for  ubiquitin A-52 residue ribosomal protein fusion product 1...
Print Version Print Version       Download Datasheet Download Datasheet       Back to search results Back to search results       Add to basket Add to basket

ubiquitin A-52 residue ribosomal protein fusion product 1 (UBA52) (Human) antibody

Overview

Image for ubiquitin A-52 residue ribosomal protein fusion product 1 (UBA52) (Human) antibody
Antigen: Ubiquitin A-52 residue ribosomal protein fusion product 1 (UBA52)
Antibody Type: Polyclonal
Application: Western Blotting (WB), ELISA
Reactivity: Human
Host: Mouse
Quantity: 50 µl
Price: 258,00 €   (Plus shipping costs , €10.00 dry ice fee and VAT)
Order number: ABIN171378
Availability: Delivery in 7 to 10 days
Hints on ordering Hints on ordering
Add to basket

on this page

Additional Information
Application Details
Images
Related Products
External Information

Customer Service

Technical Inquiry
Send product details to colleague
Download Datasheet

Additional Information:  ubiquitin A-52 residue ribosomal protein fusion product 1 (UBA52) (Human) antibody

back to top ^


Antigen Ubiquitin A-52 residue ribosomal protein fusion product 1 (UBA52)
Gene ID 7311
Immunogen UBA52 (NP_003324, 29 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. Sequence: (without GST) KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGIIEPSLR QLAQKYNCDKMICRKCYARLHPRAVNCRKKKCGHTNNLRPKKKVK*
Reactivity Human
Antibody Type Polyclonal
Description Ubiquitin A-52 residue ribosomal protein fusion product 1 Ubiquitin is a highly conserved nuclear and cytoplasmic protein that has a major role in targeting cellular proteins for degradation by the 26S proteosome. It is also involved in the maintenance of chromatin structure, the regulation of gene expression, and the stress response. Ubiquitin is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin moiety fused to an unrelated protein. This gene encodes a fusion protein consisting of ubiquitin at the N terminus and ribosomal protein L40 at the C terminus, a C-terminal extension protein (CEP). Multiple processed pseudogenes derived from this gene are present in the genome. Mouse polyclonal antibody raised against a partial recombinant UBA52. Synonyms: CEP52, HUBCEP52, MGC126879, MGC126881, MGC57125, RPL40
Host Mouse

Application Details:  ubiquitin A-52 residue ribosomal protein fusion product 1 (UBA52) (Human) antibody

back to top ^


Application Western Blotting (WB), ELISA
Application Notes Quality Control: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Buffer In 50% Glycerol Western Blot detection against Immunogen (37.11 KDa) .
Storage Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Restrictions For Research Use only

Images:  ubiquitin A-52 residue ribosomal protein fusion product 1 (UBA52) (Human) antibody

back to top ^


Western Blot detection against Immunogen (37.11 KDa) .

Image for ubiquitin A-52 residue ribosomal protein fusion product 1 (UBA52) (Human) antibody (1)

External Information:  ubiquitin A-52 residue ribosomal protein fusion product 1 (UBA52) (Human) antibody

back to top ^


Google Scholar Find more references for antigen UBA52 on Google Scholar™
EMBL Harvester Search human, mouse or rat genome for antigen UBA52 (Bioinformatic Harvester (EMBL))