anti-Rat (Rattus) Metadherin antibody for Immunocytochemistry

Recommended Metadherin Antibody (supplied by: Log in to see )

Antigen
Metadherin (MTDH) Antibodies
  • MGC75963
  • 2610103J23Rik
  • 3D3
  • 3D3/Lyric
  • AEG-1
  • AV353288
  • D8Bwg1112e
  • Lyric
  • AEG1
  • LYRIC
  • LYRIC/3D3
  • metadherin
  • mtdh
  • MTDH
  • Mtdh
Reactivity
Human, Mouse (Murine), Rat (Rattus)
101
33
29
3
1
1
1
1
1
Host
Rabbit
58
42
3
Clonality
Polyclonal
Conjugate
Un-conjugated
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
88
45
35
34
27
13
10
6
4
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4332036
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN2854801 ICC IF IHC (p) WB Rabbit IgG Center Log in to see Polyclonal

General

Antigen Metadherin (MTDH) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(101), (33), (29), (3), (1), (1), (1), (1), (1)
Host Rabbit
(58), (42), (3)
Clonality
Polyclonal
Conjugate Un-conjugated
(2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(88), (45), (35), (34), (27), (13), (10), (6), (4), (2), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product details

Target Details Application Details Handling References Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:RKTEPSAWSQDTGDANTNGKDWGRSWSDRSIFSGIGSTAEPVSQSTTSDYQWDVSRNQPYIDDEWSGLNGLSSADPNSDWNAPAEEWGNWVDEERASLLKSQEPIPDDQKVSDDDKEKGEGALPTGKSKKKKKKKKKQGEDNSTAQD
Isotype IgG

Target Details

Product details Application Details Handling References Images back to top
Antigen
Alternative Name LYRIC (MTDH Antibody Abstract)
Background Gene Symbol: MTDH
Gene ID 92140
Research Area Microfilaments, Cytoskeleton, Cancer
Pathways Cellular Response to Molecule of Bacterial Origin, Cell-Cell Junction Organization

Application Details

Product details Target Details Handling References Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:500 - 1:1000For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product details Target Details Application Details References Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References

Product details Target Details Application Details Handling Images back to top
Product cited in:

Liu, Wu, Peng: "Astrocyte elevated gene-1 regulates osteosarcoma cell invasion and chemoresistance via endothelin-1/endothelin A receptor signaling." in: Oncology letters, Vol. 5, Issue 2, pp. 505-510, 2013

Images

Product details Target Details Application Details Handling References back to top
Supplier Images
Western Blotting (WB) image for anti-Metadherin (MTDH) antibody (ABIN4332036) Western Blot: LYRIC Antibody [NBP1-90328] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56...
Western Blotting (WB) image for anti-Metadherin (MTDH) antibody (ABIN4332036) Western Blot: LYRIC Antibody [NBP1-90328] - Lane 1: NIH-3T3 cell lysate (Mouse embryo...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Metadherin (MTDH) antibody (ABIN4332036) Immunohistochemistry-Paraffin: LYRIC Antibody [NBP1-90328] - Staining of human cerebr...
Immunofluorescence (IF) image for anti-Metadherin (MTDH) antibody (ABIN4332036) Immunocytochemistry/Immunofluorescence: LYRIC Antibody [NBP1-90328] - Staining of hum...