You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Fruit Fly (Drosophila melanogaster) Adipsin antibody for Western Blotting

Recommended Adipsin Antibody (supplied by: Log in to see )

Antigen
Complement Factor D (CFD) Antibodies
  • 10.5
  • 10.9
  • 14.10
  • 20.35
  • CG2328
  • Dmel\\CG2328
  • E(eve)
  • EVE
  • Eve
  • F
  • V
  • VI
  • eve2
  • even
  • l(2)46CFg
  • l(2)46CFh
  • l(2)46CFj
  • l(2)46CFp
  • l(2)46Ce
  • l(2)46Cg
  • CFD
  • adipsin
  • pfd
  • cfdl
  • wu:fb61f12
  • zgc:109940
  • DF
  • ADIPSIN
  • ADN
  • PFD
  • Adn
  • Df
  • even skipped
  • complement factor D (adipsin)
  • complement factor D
  • eve
  • CFD
  • cfd
  • LOC396877
  • Cfd
Epitope
N-Term
15
7
6
6
5
5
4
4
4
3
3
2
1
1
1
Reactivity
Fruit Fly (Drosophila melanogaster)
82
30
18
2
2
1
1
Host
Rabbit
70
35
7
4
2
Clonality
Polyclonal
Conjugate
This Adipsin antibody is un-conjugated
15
5
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Western Blotting (WB)
97
78
14
6
5
4
3
3
3
1
Options
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN2783154
$ 289.00
Plus shipping costs $45.00
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
3.0313773 ABIN2463105 ELISA WB Rabbit Log in to see Polyclonal
1 ABIN631122 WB Rabbit N-Term Log in to see Polyclonal

Similar anti-Adipsin Antibodies

Application / Reactivity Fruit Fly (Drosophila melanogaster)
ELISA 1 Antibodies
Western Blotting (WB) 3 Antibodies

General

Antigen Complement Factor D (CFD) Antibodies
Epitope N-Term
(15), (7), (6), (6), (5), (5), (4), (4), (4), (3), (3), (2), (1), (1), (1)
Reactivity Fruit Fly (Drosophila melanogaster)
(82), (30), (18), (2), (2), (1), (1)
Host Rabbit
(70), (35), (7), (4), (2)
Clonality
Polyclonal
Conjugate This Adipsin antibody is un-conjugated
(15), (5), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Western Blotting (WB)
(97), (78), (14), (6), (5), (4), (3), (3), (3), (1)
Supplier Log in to see

Product Details anti-Adipsin Antibody

Target Details Adipsin Application Details Handling Images
Blocking Peptide Blocking peptide for this product available: ABIN976485
Sequence MHGYRTYNMESHHAHHDASPVDQKPLVVDLLATQYGKPQT PPPSPNECLS
Characteristics This is a rabbit polyclonal antibody against eve. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Immunogen Synthetic peptide corresponding to a region of Fruit fly eve

Target Details Adipsin

Product Details anti-Adipsin Antibody Application Details Handling Images back to top
Antigen
Alternative Name eve (CFD Antibody Abstract)
Background Eve may play a role in determining neuronal identity. It may be directly involved in specifying identity of individual neurons. It is a pair-rule protein required for segmentation, involved in transforming the broad, spatial, aperiodic expression patterns of the gap genes into a system of precise periodic expression patterns of the pair-rule and segmentary polarity genes.
Molecular Weight 40 kDa
Gene ID 36039
NCBI Accession NM_078946, NP_523670
UniProt P06602
Pathways Complement System

Application Details

Product Details anti-Adipsin Antibody Target Details Adipsin Handling Images back to top
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 376 AA

Restrictions For Research Use only

Handling

Product Details anti-Adipsin Antibody Target Details Adipsin Application Details Images back to top
Format Liquid
Concentration 1 mg/mL
Buffer Liquid. Purified antibody supplied in 1x PBS buffer with 0.09 % (w/v) sodium azide and 2 % sucrose.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C

Images

Product Details anti-Adipsin Antibody Target Details Adipsin Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-Adipsin antibody (Complement Factor D) (N-Term) (ABIN2783154) anti-Complement Factor D (CFD) (N-Term) antibody