anti-Human CD55 antibody for Immunohistochemistry

Recommended CD55 Antibody (supplied by: Log in to see )

Antigen
Complement Decay-Accelerating Factor (CD55) Antibodies
  • Daf
  • Daf-GPI
  • Daf1
  • GPI-DAF
  • CR
  • CROM
  • DAF
  • TC
  • AI323748
  • Cd55b
  • Daf-TM
  • TM-DAF
  • CD55 antigen
  • CD55 molecule, decay accelerating factor for complement (Cromer blood group)
  • decay accelerating factor 2
  • Cd55
  • CD55
  • Daf2
Reactivity
Human
405
56
22
9
9
4
3
2
2
2
Host
Rabbit
336
92
24
8
7
3
3
Clonality
Polyclonal
Conjugate
This CD55 antibody is un-conjugated
52
47
30
13
11
11
10
9
8
8
6
6
6
6
6
6
5
5
5
4
4
4
3
3
2
2
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
357
181
95
63
54
53
42
37
11
6
6
6
5
5
2
2
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4294817
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
9.804326 ABIN2469883 FACS IP IHC Mouse IgM Domain SCR4 Log in to see MEM-118
9.804326 ABIN2470853 FACS IHC Mouse IgG1 kappa Log in to see 143-30
9.804326 ABIN4294816 ELISA ICC IF IHC WB Rabbit C-Term Log in to see Polyclonal
9.804326 ABIN3030560 FACS IF IHC ELISA WB Rabbit Ig Fraction AA 51-79 Log in to see Polyclonal
1 ABIN610151 FACS IHC PE Mouse IgG1, kappa Log in to see 67 2
1 ABIN610148 FACS IHC Mouse IgG1, kappa Log in to see 67 2
1 ABIN135797 FACS IHC PE Mouse IgG1 Log in to see 143-30
1 ABIN135798 FACS IHC SPRD Mouse IgG1 Log in to see 143-30
1 ABIN135795 FACS IHC FITC Mouse IgG1 Log in to see 143-30
1 ABIN610152 FACS IHC Mouse IgG1, kappa Log in to see 67 2
1 ABIN135794 FACS IHC Mouse IgG1 Log in to see 143-30
1 ABIN1871642 IF IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN3021785 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN610149 FACS IHC Biotin Mouse IgG1, kappa Log in to see 67
1 ABIN610150 FACS IHC FITC Mouse IgG1, kappa Log in to see 67
1 ABIN1867506 ICC IHC IP WB Rabbit IgG AA 35-285 Log in to see Polyclonal
1 ABIN1973433 FACS IF IHC ELISA WB HRP Rabbit IgG AA 51-79 Log in to see Polyclonal
1 ABIN1961700 FACS IF IHC ELISA WB Alkaline Phosphatase (AP) Rabbit IgG AA 51-79 Log in to see Polyclonal
1 ABIN1975097 FACS IF IHC ELISA WB PE Rabbit IgG AA 51-79 Log in to see Polyclonal
1 ABIN1970516 FACS IF IHC ELISA WB FITC Rabbit IgG AA 51-79 Log in to see Polyclonal

Top referenced anti-CD55 antibody for Immunohistochemistry

Similar anti-CD55 Antibodies

Application / Reactivity Human
Cell Culture (CC) 1 Antibodies
Cytometry by Time of Flight (CyTOF) 5 Antibodies
ELISA 48 Antibodies
ELISA (Detection) 1 Antibodies
Enzyme Immunoassay (EIA) 2 Antibodies
Flow Cytometry (FACS) 306 Antibodies
Functional Studies (Func) 3 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 8 Antibodies
Immunofluorescence (IF) 51 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 5 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 1 Antibodies
Immunohistochemistry (IHC) 93 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 47 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 38 Antibodies
Immunoprecipitation (IP) 40 Antibodies

General

Antigen Complement Decay-Accelerating Factor (CD55) Antibodies
Reactivity Human
(405), (56), (22), (9), (9), (4), (3), (2), (2), (2)
Host Rabbit
(336), (92), (24), (8), (7), (3), (3)
Clonality
Polyclonal
Conjugate This CD55 antibody is un-conjugated
(52), (47), (30), (13), (11), (11), (10), (9), (8), (8), (6), (6), (6), (6), (6), (6), (5), (5), (5), (4), (4), (4), (3), (3), (2), (2), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(357), (181), (95), (63), (54), (53), (42), (37), (11), (6), (6), (6), (5), (5), (2), (2), (1), (1), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-CD55 Antibody

Target Details CD55 Application Details Handling ProductDetails: References for anti-CD55 antibody (ABIN4294817) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISF
Isotype IgG

Target Details CD55

Product Details anti-CD55 Antibody Application Details Handling ProductDetails: References for anti-CD55 antibody (ABIN4294817) Images back to top
Antigen
Alternative Name CD55/DAF (CD55 Antibody Abstract)
Background Gene Symbol: CD55
Gene ID 1604
Pathways Complement System, Regulation of Leukocyte Mediated Immunity

Application Details

Product Details anti-CD55 Antibody Target Details CD55 Handling ProductDetails: References for anti-CD55 antibody (ABIN4294817) Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-CD55 Antibody Target Details CD55 Application Details ProductDetails: References for anti-CD55 antibody (ABIN4294817) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-CD55 antibody (ABIN4294817)

Product Details anti-CD55 Antibody Target Details CD55 Application Details Handling Images back to top
Product cited in:

Izuhara, Tatsumi, Miyagawa, Iwai, Watanabe, Yamanaka, Katsuoka, Nagashima, Okano, Yokoo: "Generation of a felinized Swine endothelial cell line by expression of feline decay-accelerating factor." in: PLoS ONE, Vol. 10, Issue 2, pp. e0117682, 2015 (Sample species: Cat (Feline)). Further details: Western Blotting,Immunohistochemistry

Images

Product Details anti-CD55 Antibody Target Details CD55 Application Details Handling ProductDetails: References for anti-CD55 antibody (ABIN4294817) back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-CD55 antibody (Complement Decay-Accelerating Factor) (ABIN4294817) Immunohistochemistry: CD55/DAF Antibody [NBP1-85466] - Staining of human lung shows s...