anti-Human CD59 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended CD59 Antibody (supplied by: Log in to see )

Antigen
CD59 Antibodies
  • 16.3A5
  • 1F5
  • EJ16
  • EJ30
  • EL32
  • G344
  • HRF-20
  • HRF20
  • MAC-IP
  • MACIF
  • MEM43
  • MIC11
  • MIN1
  • MIN2
  • MIN3
  • MIRL
  • MSK21
  • p18-20
  • Cd59a
  • Cd59b
  • MACIP
  • AA987121
  • Cd59
  • protectin
  • CD59 molecule, complement regulatory protein
  • CD59a antigen
  • CD59b antigen
  • CD59
  • Cd59
  • Cd59a
  • Cd59b
Reactivity
Human
509
43
38
23
17
14
9
8
2
2
1
1
Host
Rabbit
409
123
41
7
1
Clonality
Polyclonal
Conjugate
This CD59 antibody is un-conjugated
63
53
44
14
12
12
12
11
11
10
10
10
10
10
10
10
6
6
5
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
424
206
192
129
112
90
83
47
45
25
13
9
8
4
3
2
1
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4294896
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
11.570966 ABIN298470 FACS IHC (p) IP WB Mouse IgG2b Log in to see MEM-43-5
11.570966 ABIN290285 FACS IHC (p) IP Mouse IgG2a Log in to see MEM-43
11.570966 ABIN260113 Func ICC FACS IHC (fro) IF IHC (p) IHC WB Rat IgG2b Log in to see YTH53-1
11.570966 ABIN315138 FACS IHC (p) IHC Mouse IgG1 Log in to see 1F5
11.570966 ABIN214204 FACS IHC (p) Mouse IgG1 Log in to see 1F5
11.570966 ABIN298471 FACS IHC (fro) IHC (p) IP ELISA WB Mouse IgG2a Log in to see MEM-43
11.570966 ABIN241558 FACS IHC (p) Mouse IgG2a, kappa Log in to see p282(H19)
11.570966 ABIN337087 FACS IHC (p) IP WB Mouse IgG2a Log in to see
1 ABIN119472 FACS IHC (fro) IHC (p) WB Rat IgG2b Log in to see YTH53-1 6
1 ABIN118747 EIA FACS IHC (fro) IHC (p) IP WB Mouse IgG2a Log in to see MEM-43 4
1 ABIN3043396 FACS IHC (p) Rabbit IgG AA 26-102 Log in to see Polyclonal
1 ABIN269032 CyTOF FACS IHC IHC (p) IP WB Mouse IgG2b Log in to see MEM-43-5 2
1 ABIN118752 FACS IHC (p) IP Mouse IgG2a Log in to see MEM-43 12
1 ABIN118751 Func FACS IHC (fro) IHC (p) WB Mouse IgG2a Log in to see MEM-43 2
1 ABIN268964 BP CyTOF FACS IHC IHC (p) IP Neut Mouse IgG2a Log in to see MEM-43 5
1 ABIN400666 FACS IHC (p) IP WB Mouse IgG2b Log in to see MEM-43-5
1 ABIN94203 FACS IHC (p) IP WB Mouse IgG2b Log in to see MEM-43-5 7
1 ABIN400702 FACS IHC (p) Mouse IgG2a Log in to see p282 (H19)
1 ABIN732338 IF (p) IHC (p) Rabbit IgG AA 70-90 Log in to see Polyclonal
1 ABIN3187782 ELISA IHC (p) WB Rabbit IgG Internal Region Log in to see Polyclonal

General

Antigen CD59 Antibodies
Reactivity Human
(509), (43), (38), (23), (17), (14), (9), (8), (2), (2), (1), (1)
Host Rabbit
(409), (123), (41), (7), (1)
Clonality
Polyclonal
Conjugate This CD59 antibody is un-conjugated
(63), (53), (44), (14), (12), (12), (12), (11), (11), (10), (10), (10), (10), (10), (10), (10), (6), (6), (5), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(424), (206), (192), (129), (112), (90), (83), (47), (45), (25), (13), (9), (8), (4), (3), (2), (1), (1), (1), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-CD59 Antibody

Target Details CD59 Application Details Handling References for anti-CD59 antibody (ABIN4294896) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:CYNCPNPTADCKTAVNCSSDFDACLITKAGLQVYNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGG
Isotype IgG

Target Details CD59

Product Details anti-CD59 Antibody Application Details Handling References for anti-CD59 antibody (ABIN4294896) Images back to top
Antigen
Alternative Name CD59 (CD59 Antibody Abstract)
Background Gene Symbol: CD59
Gene ID 966
UniProt P13987
Research Area Hematopoietic Progenitors, Cardiovascular, Atherosclerosis, Innate Immunity, Surface Receptors of Immune Cells, CD Antigens, Tyrosine Kinases
Pathways Complement System

Application Details

Product Details anti-CD59 Antibody Target Details CD59 Handling References for anti-CD59 antibody (ABIN4294896) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000For IHC-Paraffin HIER pH 6 retrieval is recommended.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-CD59 Antibody Target Details CD59 Application Details References for anti-CD59 antibody (ABIN4294896) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-CD59 antibody (ABIN4294896)

Product Details anti-CD59 Antibody Target Details CD59 Application Details Handling Images back to top
Product cited in:

Miyaji, Paul, Shahrizaila, Umapathi, Yuki: "Complement regulatory proteins (CD46, 55 and 59) expressed on Schwann cells: immune targets in demyelinating neuropathies?" in: Journal of neuroimmunology, Vol. 276, Issue 1-2, pp. 172-4, 2014

Images

Product Details anti-CD59 Antibody Target Details CD59 Application Details Handling References for anti-CD59 antibody (ABIN4294896) back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-CD59 (CD59) antibody (ABIN4294896) Immunohistochemistry-Paraffin: CD59 Antibody [NBP1-89405] - Staining of human urinary...
Western Blotting (WB) image for anti-CD59 (CD59) antibody (ABIN4294896) Western Blot: CD59 Antibody [NBP1-89405] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunofluorescence (IF) image for anti-CD59 (CD59) antibody (ABIN4294896) Immunocytochemistry/Immunofluorescence: CD59 Antibody - Immunofluorescent staining o...