You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Mouse (Murine) CD59 antibody for Immunochromatography

Recommended CD59 Antibody (supplied by: Log in to see )

Antigen
CD59 Antibodies
  • 16.3A5
  • 1F5
  • EJ16
  • EJ30
  • EL32
  • G344
  • HRF-20
  • HRF20
  • MAC-IP
  • MACIF
  • MEM43
  • MIC11
  • MIN1
  • MIN2
  • MIN3
  • MIRL
  • MSK21
  • p18-20
  • Cd59a
  • Cd59b
  • MACIP
  • AA987121
  • Cd59
  • protectin
  • CD59 molecule, complement regulatory protein
  • CD59a antigen
  • CD59b antigen
  • CD59
  • Cd59
  • Cd59a
  • Cd59b
Epitope
AA 22-96
15
11
10
10
9
7
6
6
5
5
5
4
4
3
2
1
Reactivity
Mouse (Murine)
474
42
35
23
17
14
9
8
2
2
1
1
Host
Rabbit
372
122
40
7
1
Clonality
Polyclonal
Conjugate
This CD59 antibody is un-conjugated
58
51
42
13
11
11
10
10
10
9
9
9
9
9
9
9
5
5
5
1
1
1
1
1
1
1
1
1
1
Application
Immunochromatography (IC), Immunohistochemistry (IHC), ELISA, Western Blotting (WB)
388
189
185
115
96
82
69
43
30
20
13
9
8
2
2
2
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Catalog No. ABIN2342600
$ 623.86
Plus shipping costs $45.00

Similar anti-CD59 Antibodies

Application / Reactivity Mouse (Murine)
Cytometry by Time of Flight (CyTOF) 1 Antibodies
ELISA 13 Antibodies
Flow Cytometry (FACS) 20 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunohistochemistry (IHC) 21 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 19 Antibodies
Immunoprecipitation (IP) 10 Antibodies
Western Blotting (WB) 33 Antibodies

General

Antigen CD59 Antibodies
Epitope AA 22-96
(15), (11), (10), (10), (9), (7), (6), (6), (5), (5), (5), (4), (4), (3), (2), (1)
Reactivity Mouse (Murine)
(474), (42), (35), (23), (17), (14), (9), (8), (2), (2), (1), (1)
Host Rabbit
(372), (122), (40), (7), (1)
Clonality
Polyclonal
Conjugate This CD59 antibody is un-conjugated
(58), (51), (42), (13), (11), (11), (10), (10), (10), (9), (9), (9), (9), (9), (9), (9), (5), (5), (5), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunochromatography (IC), Immunohistochemistry (IHC), ELISA, Western Blotting (WB)
(388), (189), (185), (115), (96), (82), (69), (43), (30), (20), (13), (9), (8), (2), (2), (2), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-CD59 Antibody

Target Details CD59 Application Details Handling Images
Sequence MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-VSLTCYHCFQ PVVSSCNMN STCSPDQDSC LYAVAGMQVY QRCWKQSDCH GEIIMDQLEE TKLKFRCCQF NLCNKS
Cross-Reactivity Mouse (Murine)
Cross-Reactivity (Details) Calculated cross reactivity: Mo
Characteristics Protectin (CD59, MIC11, MIN1, MIN2, MIN3, MSK21, P18-20, Complement Regulatory Protein)
Purification Purified by immunoaffinity chromatography.
Immunogen CD59 (Val22~Ser96), MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-VSLTCYHCF QPVVSSCNMN STCSPDQDSC LYAVAGMQVY QRCWKQSDCH GEIIMDQLEE TKLKFRCCQF NLCNKS
Isotype IgG

Target Details CD59

Product Details anti-CD59 Antibody Application Details Handling Images back to top
Antigen
Alternative Name Protectin (CD59 Antibody Abstract)
Pathways Complement System

Application Details

Product Details anti-CD59 Antibody Target Details CD59 Handling Images back to top
Application Notes Optimal working conditions should be determined by the investigator.
Restrictions For Research Use only

Handling

Product Details anti-CD59 Antibody Target Details CD59 Application Details Images back to top
Format Liquid
Buffer Supplied as a liquid in PBS, pH 7.2, 0.05 % sodium azide, 50 % glycerol.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment -20°C