anti-Mouse (Murine) Complement Factor B antibody for Western Blotting

Recommended Complement Factor B Antibody (supplied by: Log in to see )

Antigen
Complement Factor B (CFB) Antibodies
  • bf
  • Bf-1
  • Brre-Bf
  • zgc:114032
  • Bf
  • Sp152
  • bfb-A
  • Bf B
  • LOC397725
  • fc04c04
  • wu:fc04c04
  • bf/c2
  • CFB
  • AHUS4
  • BF
  • BFD
  • CFAB
  • FB
  • FBI12
  • GBG
  • H2-Bf
  • PBF2
  • AI195813
  • AI255840
  • B
  • C2
  • Fb
  • Da1-24
  • complement factor B
  • zgc:158446
  • ATP synthase, H+ transporting, mitochondrial Fo complex, subunit s (factor B)
  • complement factor B-like
  • CFB
  • cfb
  • Bf
  • bfb-A
  • LOC397725
  • zgc:158446
  • bf/c2
  • Atp5s
  • Cfb
  • LOC100355944
Reactivity
Human, Mouse (Murine), Rat (Rattus)
179
49
46
2
1
1
1
1
1
Host
Rabbit
130
57
16
7
Clonality
Polyclonal
Conjugate
This Complement Factor B antibody is un-conjugated
22
17
9
4
4
2
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
140
124
53
30
24
20
16
13
13
12
9
6
6
5
4
3
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4299962
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
2.9062016 ABIN951644 EIA IHC (p) WB Rabbit Ig AA 474-504, Middle Region Log in to see Polyclonal
2.9062016 ABIN1871801 IHC WB Rabbit IgG Log in to see Polyclonal
2.9062016 ABIN652979 FACS IHC (p) WB Rabbit Ig AA 469-494, Center Log in to see Polyclonal
2.9062016 ABIN1858373 ICC IHC IP WB Rabbit IgG AA 474-590 Log in to see Polyclonal
2.9062016 ABIN1175360 ICC IHC IP WB Rabbit IgG AA 32-157 Log in to see Polyclonal
2.9062016 ABIN2404540 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN1386781 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal
1 ABIN5514558 WB Rabbit N-Term Log in to see Polyclonal
1 ABIN2891191 ELISA WB Rabbit IgG AA 241-290, Cleaved-Lys260 Log in to see Polyclonal
1 ABIN1415523 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
1 ABIN1397650 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
1 ABIN2619159 WB Rabbit Internal Region Log in to see Polyclonal
1 ABIN2879874 IHC WB Rabbit IgG Log in to see Polyclonal
1 ABIN1961891 ELISA WB Alkaline Phosphatase (AP) Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN1964270 ELISA WB APC Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN1966872 ELISA WB Biotin Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN1970706 ELISA WB FITC Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN1975288 ELISA WB PE Rabbit IgG Internal Region Log in to see Polyclonal
1 ABIN4299961 IHC IHC (p) SimWes WB Rabbit IgG Log in to see Polyclonal
1 ABIN2887070 IHC WB Rabbit Log in to see Polyclonal

General

Antigen Complement Factor B (CFB) Antibodies
Reactivity Human, Mouse (Murine), Rat (Rattus)
(179), (49), (46), (2), (1), (1), (1), (1), (1)
Host Rabbit
(130), (57), (16), (7)
Clonality
Polyclonal
Conjugate This Complement Factor B antibody is un-conjugated
(22), (17), (9), (4), (4), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Simple Western (SimWes), Western Blotting (WB)
(140), (124), (53), (30), (24), (20), (16), (13), (13), (12), (9), (6), (6), (5), (4), (3), (1), (1), (1)
Pubmed 4 references available
Supplier Log in to see

Product Details anti-Complement Factor B Antibody

Target Details Complement Factor B Application Details Handling ProductDetails: References for anti-Complement Factor B antibody (ABIN4299962) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:KDNEQHVFKVKDMENLEDVFYQMIDESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFTVDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYG
Isotype IgG

Target Details Complement Factor B

Product Details anti-Complement Factor B Antibody Application Details Handling ProductDetails: References for anti-Complement Factor B antibody (ABIN4299962) Images back to top
Antigen
Alternative Name Complement Factor B (CFB Antibody Abstract)
Background Gene Symbol: CFB
Gene ID 629
Pathways Complement System, Proton Transport, Ribonucleoside Biosynthetic Process

Application Details

Product Details anti-Complement Factor B Antibody Target Details Complement Factor B Handling ProductDetails: References for anti-Complement Factor B antibody (ABIN4299962) Images back to top
Application Notes Western Blot 1:100-1:500, Simple Western 1:20, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200-1:500Immunohistochemistry retrieval recommended: HIER pH 6. In Simple Western only 10 - 15 μL of the recommended dilution is used per data point. Separated by Size-Wes, Sally Sue/Peggy Sue.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-Complement Factor B Antibody Target Details Complement Factor B Application Details ProductDetails: References for anti-Complement Factor B antibody (ABIN4299962) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-Complement Factor B antibody (ABIN4299962)

Product Details anti-Complement Factor B Antibody Target Details Complement Factor B Application Details Handling Images back to top
Product cited in:

Yamanaka, Kakuta, Miyagawa, Nakazawa, Kato, Abe, Imamura, Okumi, Maeda, Okuyama, Mizuno, Nonomura: "Depression of Complement Regulatory Factors in Rat and Human Renal Grafts Is Associated with the Progress of Acute T-Cell Mediated Rejection." in: PLoS ONE, Vol. 11, Issue 2, pp. e0148881, 2016 (Sample species: Rat (Rattus)). Further details: Immunohistochemistry (Frozen Sections)

Cima, Schiess, Wild, Kaelin, Schüffler, Lange, Picotti, Ossola, Templeton, Schubert, Fuchs, Leippold, Wyler, Zehetner, Jochum, Buhmann, Cerny, Moch, Gillessen, Aebersold, Krek: "Cancer genetics-guided discovery of serum biomarker signatures for diagnosis and prognosis of prostate cancer." in: Proceedings of the National Academy of Sciences of the United States of America, Vol. 108, Issue 8, pp. 3342-7, 2011

Kato, Nicholson, Neiman, Rantalainen, Holmes, Barrett, Uhlén, Nilsson, Spector, Schwenk: "Variance decomposition of protein profiles from antibody arrays using a longitudinal twin model." in: Proteome science, Vol. 9, pp. 73, 2011

Singh, Kapoun, Higgins, Kutschke, Thurman, Zhang, Singh, Yang, Guan, Lowe, Weiss, Zimmermann, Yull, Blackwell, Mohler, Anderson: "Ca2+/calmodulin-dependent kinase II triggers cell membrane injury by inducing complement factor B gene expression in the mouse heart." in: The Journal of clinical investigation, Vol. 119, Issue 4, pp. 986-96, 2009

Images

Product Details anti-Complement Factor B Antibody Target Details Complement Factor B Application Details Handling ProductDetails: References for anti-Complement Factor B antibody (ABIN4299962) back to top
Supplier Images
Simple Western (SimWes) image for anti-Complement Factor B (CFB) antibody (ABIN4299962) Simple Western: Complement Factor B Antibody [NBP1-89985] - Simple Western lane view ...
Western Blotting (WB) image for anti-Complement Factor B (CFB) antibody (ABIN4299962) Western Blot: Complement Factor B Antibody [NBP1-89985] - Lane 1: NIH-3T3 cell lysate...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-Complement Factor B (CFB) antibody (ABIN4299962) Immunohistochemistry-Paraffin: Complement Factor B Antibody [NBP1-89985] - Staining o...
Western Blotting (WB) image for anti-Complement Factor B (CFB) antibody (ABIN4299962) Western Blot: Complement Factor B Antibody [NBP1-89985] - Lane 1: Marker [kDa] 219, 1...
Simple Western (SimWes) image for anti-Complement Factor B (CFB) antibody (ABIN4299962) Simple Western: Complement Factor B Antibody [NBP1-89985] - Electropherogram image(s)...