You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human FCN1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended FCN1 Antibody (supplied by: Log in to see )

Antigen
Ficolin (Collagen/fibrinogen Domain Containing) 1 (FCN1) Antibodies
  • FCN1
  • Fcn1
  • FCN2
  • Fcna
  • FCNB
  • FCNM
Reactivity
Human
75
9
8
1
1
Host
Rabbit
68
18
Clonality
Polyclonal
Conjugate
This FCN1 antibody is un-conjugated
4
4
2
2
2
2
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
62
45
7
6
3
3
3
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4311880
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.23808794 ABIN2649289 IHC (p) Mouse Log in to see
0.000899519 ABIN1997803 IHC (p) ELISA Rabbit IgG AA 1-326 Log in to see Polyclonal
0.000899519 ABIN1997799 IHC (p) Rabbit IgG AA 1-326 Log in to see
0.000899519 ABIN1858840 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG AA 45-249 Log in to see Polyclonal
0.000899519 ABIN4311879 IHC IHC (p) WB Rabbit IgG Log in to see Polyclonal 1

Top referenced anti-FCN1 antibody for Immunohistochemistry (Paraffin-embedded Sections)

Similar anti-FCN1 Antibodies

Application / Reactivity Human
ELISA 40 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 1 Antibodies
Immunohistochemistry (IHC) 7 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 6 Antibodies
Immunoprecipitation (IP) 3 Antibodies
Western Blotting (WB) 56 Antibodies

General

Antigen Ficolin (Collagen/fibrinogen Domain Containing) 1 (FCN1) Antibodies
Reactivity Human
(75), (9), (8), (1), (1)
Host Rabbit
(68), (18)
Clonality
Polyclonal
Conjugate This FCN1 antibody is un-conjugated
(4), (4), (2), (2), (2), (2)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(62), (45), (7), (6), (3), (3), (3), (1)
Pubmed 2 references available
Supplier Log in to see

Product Details anti-FCN1 Antibody

Target Details FCN1 Application Details Handling References for anti-FCN1 Antibody (ABIN4311880) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:LAVLLVLFLHIKNLPAQAADTCPEVKVVGLEGSDKLTILRGCPGLPGAPGPKGEAGVIGERGERGLPGAPGKAGPVGPKGDRGEKGMRGEKGDAGQSQSCATGPRNCKD
Isotype IgG

Target Details FCN1

Product Details anti-FCN1 Antibody Application Details Handling References for anti-FCN1 Antibody (ABIN4311880) Images back to top
Antigen
Alternative Name Ficolin-1 (FCN1 Antibody Abstract)
Background Gene Symbol: FCN1
Pathways Complement System

Application Details

Product Details anti-FCN1 Antibody Target Details FCN1 Handling References for anti-FCN1 Antibody (ABIN4311880) Images back to top
Application Notes Western Blot 1:250 - 1:500, Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-FCN1 Antibody Target Details FCN1 Application Details References for anti-FCN1 Antibody (ABIN4311880) Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-FCN1 Antibody (ABIN4311880)

Product Details anti-FCN1 Antibody Target Details FCN1 Application Details Handling Images back to top
Product cited in:

Okuzaki, Kimura, Yabuta, Ohmine, Nojima: "LeukoCatch, a quick and efficient tool for the preparation of leukocyte extracts from blood." in: BMC clinical pathology, Vol. 11, pp. 9, 2011

Ek, Andréasson, Hober, Kampf, Pontén, Uhlén, Merz, Borrebaeck: "From gene expression analysis to tissue microarrays: a rational approach to identify therapeutic and diagnostic targets in lymphoid malignancies." in: Molecular & cellular proteomics : MCP, Vol. 5, Issue 6, pp. 1072-81, 2006

Images

Product Details anti-FCN1 Antibody Target Details FCN1 Application Details Handling References for anti-FCN1 Antibody (ABIN4311880) back to top
Supplier Images
Western Blotting (WB) image for anti-FCN1 antibody (Ficolin (Collagen/fibrinogen Domain Containing) 1) (ABIN4311880) Western Blot: FCN1 Antibody [NBP1-84706] - Lane 1: Marker [kDa] 219, 112, 85, 49, 32,...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-FCN1 antibody (Ficolin (Collagen/fibrinogen Domain Containing) 1) (ABIN4311880) Immunohistochemistry-Paraffin: FCN1 Antibody [NBP1-84706] - Staining of human bone ma...
Western Blotting (WB) image for anti-FCN1 antibody (Ficolin (Collagen/fibrinogen Domain Containing) 1) (ABIN4311880) Western Blot: Ficolin-1 Antibody [NBP1-84706] - Lane 1: Marker [kDa] 219, 112, 85, 49...