anti-Human PLG antibody for Immunohistochemistry

Recommended PLG Antibody (supplied by: Log in to see )

Plasminogen (PLG) Antibodies
  • wu:fb70e09
  • PLG
  • LPA
  • plg
  • Ab1-346
  • AI649309
  • Pg
  • plasminogen
  • plasminogen-like
  • plg
  • PLG
  • Plg
  • LOC100725098
  • LOC100050531
This PLG antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4346086
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
9.673683 ABIN4346088 IHC WB Rabbit IgG Log in to see Polyclonal
9.673683 ABIN2433617 IHC ELISA WB Rabbit IgG Log in to see Polyclonal
1 ABIN4346087 ICC IF IHC IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
1 ABIN236063 IHC ELISA Mouse IgG1 Log in to see 5H3
1 ABIN1860259 ICC IHC IP WB Rabbit IgG AA 79-466 Log in to see Polyclonal
1 ABIN1078446 ICC IHC IP WB Rabbit IgG AA 274-560 Log in to see Polyclonal
1 ABIN345659 IHC Purif Mouse IgG2b Log in to see 4D2
1 ABIN265680 IHC (p) IP IHC ELISA Mouse IgG2a Log in to see 9D8
1 ABIN299422 IHC ELISA Mouse IgG2b Log in to see 4D2
1 ABIN295170 IHC ELISA Mouse IgG1 Log in to see 5H3
1 ABIN295171 IHC ELISA Mouse IgG1 Log in to see 3C2
1 ABIN295164 IF IHC ELISA WB Biotin Goat IgG Log in to see Polyclonal
1 ABIN295169 IHC ELISA Mouse IgG1 Log in to see 8E7
1 ABIN259570 IHC (p) IHC ELISA Mouse IgG1 Log in to see 3C2
1 ABIN299166 IHC ELISA Mouse IgG2a Log in to see 9D8
1 ABIN299401 IHC ELISA Mouse IgG2a Log in to see 9E7
1 ABIN297919 IHC ELISA Mouse IgG1 Log in to see 8F11
1 ABIN4238551 ELISA IHC IHC (p) DyLight 680 Mouse IgG2b Log in to see 4D2
1 ABIN4238490 ELISA IHC IHC (p) DyLight 405 Mouse IgG1 Log in to see 8F11
1 ABIN4238550 ELISA IHC IHC (p) FITC Mouse IgG2b Log in to see 4D2

Top referenced anti-PLG antibody for Immunohistochemistry

Similar anti-PLG Antibodies

Application / Reactivity Human
Dot Blot (DB) 4 Antibodies
ELISA 271 Antibodies
ELISA (Capture) 4 Antibodies
ELISA (Detection) 15 Antibodies
Enzyme Immunoassay (EIA) 13 Antibodies
Flow Cytometry (FACS) 6 Antibodies
Gel Shift (GS) 1 Antibodies
Immunoassay (IA) 2 Antibodies
Immunocytochemistry (ICC) 7 Antibodies
Immunodiffusion (ID) 17 Antibodies
Immunoelectrophoresis (IEP) 8 Antibodies
Immunofluorescence (IF) 19 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 3 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 127 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 8 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 123 Antibodies


Antigen Plasminogen (PLG) Antibodies
Reactivity Human
(408), (88), (56), (6), (5), (4), (4), (4), (3), (2), (1), (1)
Host Rabbit
(221), (154), (48), (40), (12)
Conjugate This PLG antibody is un-conjugated
(35), (24), (22), (8), (6), (6), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (4), (4), (4), (4), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(305), (211), (131), (123), (35), (27), (19), (19), (17), (15), (15), (13), (10), (8), (6), (5), (4), (4), (4), (2), (2), (2), (1), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-PLG Antibody

Target Details PLG Application Details Handling ProductDetails: References for anti-PLG antibody (ABIN4346086) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPE
Isotype IgG

Target Details PLG

Product Details anti-PLG Antibody Application Details Handling ProductDetails: References for anti-PLG antibody (ABIN4346086) Images back to top
Alternative Name Plasminogen (PLG Antibody Abstract)
Background Gene Symbol: PLG
Gene ID 5340
Research Area Angiogenesis, Proteolysis / Ubiquitin, Proteases, Coagulation
Pathways Complement System

Application Details

Product Details anti-PLG Antibody Target Details PLG Handling ProductDetails: References for anti-PLG antibody (ABIN4346086) Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50For IHC-Paraffin HIER pH 6 retrieval is recommended.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-PLG Antibody Target Details PLG Application Details ProductDetails: References for anti-PLG antibody (ABIN4346086) Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

ProductDetails: References for anti-PLG antibody (ABIN4346086)

Product Details anti-PLG Antibody Target Details PLG Application Details Handling Images back to top
Product cited in:

Gründel, Friedrich, Pfeiffer, Jacobs, Dumke: "Subunits of the Pyruvate Dehydrogenase Cluster of Mycoplasma pneumoniae Are Surface-Displayed Proteins that Bind and Activate Human Plasminogen." in: PLoS ONE, Vol. 10, Issue 5, pp. e0126600, 2015 (Sample species: Human). Further details: ELISA


Product Details anti-PLG Antibody Target Details PLG Application Details Handling ProductDetails: References for anti-PLG antibody (ABIN4346086) back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-PLG antibody (Plasminogen) (ABIN4346086) Immunohistochemistry: Plasminogen Antibody [NBP1-86015] - Staining of human colon sho...