You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human PLG antibody for Immunohistochemistry

Recommended PLG Antibody (supplied by: Log in to see )

Plasminogen (PLG) Antibodies
  • Ab1-346
  • AI649309
  • LPA
  • Pg
  • plg
  • PLG
  • wu:fb70e09
This PLG antibody is un-conjugated
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4346086
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.2160426 ABIN2492985 FACS IHC ELISA WB Rabbit Ig Fraction C-Term Log in to see Polyclonal
0.2160426 ABIN2433617 IHC ELISA WB Rabbit IgG Log in to see Polyclonal
0.2160426 ABIN4346088 IHC WB Rabbit IgG Log in to see Polyclonal
0.0011682691 ABIN236063 IHC ELISA Mouse IgG1 Log in to see 5H3
0.0011682691 ABIN295164 IF IHC ELISA WB Biotin Goat IgG Log in to see Polyclonal
0.0011682691 ABIN265680 IHC (p) IP IHC ELISA Mouse IgG2a Log in to see 9D8
0.0011682691 ABIN295170 IHC ELISA Mouse IgG1 Log in to see 5H3
0.0011682691 ABIN295169 IHC ELISA Mouse IgG1 Log in to see 8E7
0.0011682691 ABIN295171 IHC ELISA Mouse IgG1 Log in to see 3C2
0.0011682691 ABIN299422 IHC ELISA Mouse IgG2b Log in to see 4D2
0.0011682691 ABIN299166 IHC ELISA Mouse IgG2a Log in to see 9D8
0.0011682691 ABIN259570 IHC (p) IHC ELISA Mouse IgG1 Log in to see 3C2
0.0011682691 ABIN297919 IHC ELISA Mouse IgG1 Log in to see 8F11
0.0011682691 ABIN299401 IHC ELISA Mouse IgG2a Log in to see 9E7
0.0011682691 ABIN265682 IHC (p) IP IHC ELISA Mouse IgG1 Log in to see 8F11
0.0011682691 ABIN345659 IHC Purif Mouse IgG2b Log in to see 4D2
0.0011682691 ABIN259571 IHC (p) IHC ELISA Mouse IgG1 Log in to see 5H3
0.0011682691 ABIN259572 IHC (p) IHC ELISA Mouse IgG2b Log in to see 4D2
0.0011682691 ABIN265681 IHC (p) IHC ELISA Mouse IgG1 Log in to see 8-00E07
0.0011682691 ABIN265679 IHC (p) IP IHC ELISA Mouse IgG2a Log in to see 9-00E07

Top referenced anti-PLG antibody for Immunohistochemistry

Similar anti-PLG Antibodies

Application / Reactivity Human
Dot Blot (DB) 4 Antibodies
ELISA 271 Antibodies
ELISA (Capture) 4 Antibodies
ELISA (Detection) 15 Antibodies
Enzyme Immunoassay (EIA) 13 Antibodies
Flow Cytometry (FACS) 6 Antibodies
Gel Shift (GS) 1 Antibodies
Immunoassay (IA) 3 Antibodies
Immunocytochemistry (ICC) 7 Antibodies
Immunodiffusion (ID) 17 Antibodies
Immunoelectrophoresis (IEP) 8 Antibodies
Immunofluorescence (IF) 19 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 12 Antibodies
Immunohistochemistry (IHC) 67 Antibodies
Immunohistochemistry (Acetone-fixed) (IHC (af)) 1 Antibodies
Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp)) 3 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 10 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 114 Antibodies
Immunoprecipitation (IP) 30 Antibodies


Antigen Plasminogen (PLG) Antibodies
Reactivity Human
(398), (86), (48), (4), (3), (2), (2), (2), (2), (2)
Host Rabbit
(216), (149), (47), (42), (14)
Conjugate This PLG antibody is un-conjugated
(35), (24), (23), (8), (6), (6), (5), (5), (5), (5), (5), (5), (5), (5), (5), (5), (4), (4), (4), (4), (2), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(308), (194), (117), (67), (30), (27), (19), (19), (18), (17), (16), (12), (9), (8), (6), (5), (4), (4), (3), (3), (2), (2), (1), (1), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-PLG Antibody

Target Details PLG Application Details Handling References for anti-PLG Antibody (ABIN4346086) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NKRWELCDIPRCTTPPPSSGPTYQCLKGTGENYRGNVAVTVSGHTCQHWSAQTPHTHNRTPE
Isotype IgG

Target Details PLG

Product Details anti-PLG Antibody Application Details Handling References for anti-PLG Antibody (ABIN4346086) Images back to top
Alternative Name Plasminogen (PLG Antibody Abstract)
Background Gene Symbol: PLG
Research Area Angiogenesis, Proteolysis / Ubiquitin, Proteases, Coagulation
Pathways Complement System

Application Details

Product Details anti-PLG Antibody Target Details PLG Handling References for anti-PLG Antibody (ABIN4346086) Images back to top
Application Notes Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-PLG Antibody Target Details PLG Application Details References for anti-PLG Antibody (ABIN4346086) Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-PLG Antibody (ABIN4346086)

Product Details anti-PLG Antibody Target Details PLG Application Details Handling Images back to top
Product cited in:

Gründel, Friedrich, Pfeiffer, Jacobs, Dumke: "Subunits of the Pyruvate Dehydrogenase Cluster of Mycoplasma pneumoniae Are Surface-Displayed Proteins that Bind and Activate Human Plasminogen." in: PLoS ONE, Vol. 10, Issue 5, pp. e0126600, 2015 (Sample species: Human). Further details: ELISA


Product Details anti-PLG Antibody Target Details PLG Application Details Handling References for anti-PLG Antibody (ABIN4346086) back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-PLG antibody (Plasminogen) (ABIN4346086) Immunohistochemistry: Plasminogen Antibody [NBP1-86015] - Staining of human colon sho...