You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Rat (Rattus) SERPING1 antibody for Immunochromatography

Recommended SERPING1 Antibody (supplied by: Log in to see )

Antigen
Serpin Peptidase Inhibitor, Clade G (C1 Inhibitor), Member 1 (SERPING1) Antibodies
  • C1-INH
  • C1IN
  • C1INH
  • C1nh
  • C1NH
  • fb64f02
  • HAE1
  • HAE2
  • im:7159527
  • LOC100136072
  • si:dkeyp-110g5.2
  • wu:fb60c09
  • wu:fb62a08
  • wu:fb64f02
Epitope
AA 148-270
11
4
4
4
4
3
3
3
2
2
2
1
1
Reactivity
Rat (Rattus)
64
19
15
3
2
2
1
Host
Rabbit
46
16
11
5
1
Clonality
Polyclonal
Conjugate
This SERPING1 antibody is un-conjugated
3
3
Application
Immunochromatography (IC), Immunohistochemistry (IHC), ELISA, Western Blotting (WB)
49
45
24
16
8
8
6
5
4
3
2
2
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Catalog No. ABIN2358636
$ 561.00
Plus shipping costs $45.00

Similar anti-SERPING1 Antibodies

Application / Reactivity Rat (Rattus)
ELISA 8 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunohistochemistry (IHC) 7 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 2 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 2 Antibodies
Western Blotting (WB) 13 Antibodies

General

Antigen Serpin Peptidase Inhibitor, Clade G (C1 Inhibitor), Member 1 (SERPING1) Antibodies
Epitope AA 148-270
(11), (4), (4), (4), (4), (3), (3), (3), (2), (2), (2), (1), (1)
Reactivity Rat (Rattus)
(64), (19), (15), (3), (2), (2), (1)
Host Rabbit
(46), (16), (11), (5), (1)
Clonality
Polyclonal
Conjugate This SERPING1 antibody is un-conjugated
(3), (3)
Application Immunochromatography (IC), Immunohistochemistry (IHC), ELISA, Western Blotting (WB)
(49), (45), (24), (16), (8), (8), (6), (5), (4), (3), (2), (2), (1), (1), (1)
Supplier Log in to see

Product Details anti-SERPING1 Antibody

Target Details SERPING1 Application Details Handling Images
Sequence MHHHHHHSSG LVPRGSGMKE TAAAKFERQH MDSPDLGTDD DDKAMADIGS EF-SEALTDFSVK LYH AFSATKKAET NMAFSPFSIA SLLTQVLLGA GDSTKSNLED ILSYPKDFAC VHQTLKAFSS KGVTSVSQIF HSPDLAIRDT YVNASLSLYG SSPRVLGPDG DANLKLINTW
Cross-Reactivity Rat (Rattus)
Cross-Reactivity (Details) Calculated cross reactivity: Rt
Characteristics SERPING1 (Plasma Protease C1 Inhibitor, C1 Inh, C1Inh, C1 Esterase Inhibitor, C1-inhibiting Factor, Serpin G1, C1IN, C1NH)
Purification Purified by immunoaffinity chromatography.
Immunogen C1INH (Ser148~Trp270), MHHHHHHSSGLVPRGSGMKETAAAKFERQHMDSPDLGTDDDDKAMADIGSEF-SEA LTDFSVKLYH AFSATKKAET NMAFSPFSIA SLLTQVLLGA GDSTKSNLED ILSYPKDFAC VHQTLKAFSS KGVTSVSQIF HSPDLAIRDT YVNASLSLYG SSPRVLGPDG DANLKLINTW
Isotype IgG

Target Details SERPING1

Product Details anti-SERPING1 Antibody Application Details Handling Images back to top
Antigen
Alternative Name SERPING1 (SERPING1 Antibody Abstract)
Pathways Complement System

Application Details

Product Details anti-SERPING1 Antibody Target Details SERPING1 Handling Images back to top
Application Notes Optimal working conditions should be determined by the investigator.
Restrictions For Research Use only

Handling

Product Details anti-SERPING1 Antibody Target Details SERPING1 Application Details Images back to top
Format Liquid
Buffer Supplied as a liquid in PBS, pH 7.2, 0.05 % sodium azide, 50 % glycerol.
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage -20 °C
Storage Comment -20°C