ATP2A2 antibody (N-Term)
-
- Target See all ATP2A2 Antibodies
- ATP2A2 (ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2))
-
Binding Specificity
- N-Term
-
Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ATP2A2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purification
- Antigen affinity
- Immunogen
- An amino acid sequence from the N-terminus of human ATP2A2 (MENAHTKTVEEVLGHFGVNESTGLSLEQVKKL) was used as the immunogen for this ATP2A2 antibody.
- Isotype
- IgG
- Top Product
- Discover our top product ATP2A2 Primary Antibody
-
anti-ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2) (AA 111-253) antibody
ATP2A2 Reactivity: Human WB, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2) (AA 315-756) antibodyATP2A2 Reactivity: Human WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2) (AA 314-756) antibodyATP2A2 Reactivity: Human WB, ELISA, IHC, IF Host: Rabbit Polyclonal unconjugated
anti-ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2) (Internal Region) antibodyVerified ATP2A2 Reactivity: Human, Mouse, Rat WB, ELISA, IHC, IF Host: Goat Polyclonal unconjugated
anti-ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2) (AA 1-32), (N-Term) antibodyATP2A2 Reactivity: Mouse, Rat WB, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2) (Internal Region) antibodyATP2A2 Reactivity: Human, Mouse, Rat WB, ELISA, IHC, IF, ICC Host: Rabbit Polyclonal unconjugated
anti-ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2) (C-Term) antibodyATP2A2 Reactivity: Human, Mouse, Rat WB, ELISA, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2) (AA 665-679), (Middle Region) antibodyATP2A2 Reactivity: Human, Rat WB, IHC (p) Host: Rabbit Polyclonal unconjugated
anti-ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2) (C-Term) antibodyATP2A2 Reactivity: Human, Mouse, Rat, Rabbit, Cow, Dog, Guinea Pig, Horse, Zebrafish (Danio rerio) WB, IHC Host: Rabbit Polyclonal unconjugated
anti-ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2) (C-Term) antibodyATP2A2 Reactivity: Human WB, ELISA Host: Rabbit Polyclonal unconjugated
-
- Application Notes
- The stated application concentrations are suggested starting amounts. Titration of the ATP2A2 antibody may be required due to differences in protocols and secondary/substrate sensitivity.\. Western blot: 0.5-1 μg/mL,IHC (Paraffin): 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the ATP2A2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- ATP2A2 (ATPase, Ca++ Transporting, Cardiac Muscle, Slow Twitch 2 (ATP2A2))
- Alternative Name
- ATP2A2 (ATP2A2 Products)
- Synonyms
- atp2b antibody, ca-p60a antibody, dar antibody, serca2 antibody, ATP2A2 antibody, ATP2B antibody, DAR antibody, DD antibody, SERCA2 antibody, SERCA2A antibody, ATP2 antibody, Serca2 antibody, SercaII antibody, 9530097L16Rik antibody, D5Wsu150e antibody, SERCA2B antibody, mKIAA4195 antibody, atp2a2 antibody, zgc:55380 antibody, ATPase, Ca++ transporting, cardiac muscle, fast twitch 1 S homeolog antibody, ATPase sarcoplasmic/endoplasmic reticulum Ca2+ transporting 2 antibody, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2 antibody, ATPase, Ca++ transporting, cardiac muscle, slow twitch 2a antibody, atp2a1.S antibody, ATP2A2 antibody, Atp2a2 antibody, atp2a2a antibody
- Background
- SERCA2, also called ATP2A2 or ATP2B, encodes one of the SERCA Ca(2+)-ATPases, which are intracellular pumps located in the sarcoplasmic or endoplasmic reticula of muscle cells. They are closely related to the plasma membrane Ca(2+)-ATPases, or PMCAs. SERCA2 belongs to the large family of P-type cation pumps that couple ATP hydrolysis with cation transport across membranes. The SERCA2 gene is mapped to 12q24.11. SERCA2 was expressed in all specimens, with pronounced expression in the subnuclear aspect of basal epidermal keratinocytes. There was variable suprabasal expression. SERCA2 expression was also observed in the infundibulum and outer root sheath of hair follicles, germinative and mature cells of sebaceous glands, secretory coil and duct of eccrine glands, apocrine gland cells, and arrector pili muscle. In Darier disease skin, strong SERCA2 positivity was detected in the basal, suprabasal, and acantholytic lesional cells.
- Gene ID
- 488
- Pathways
- Myometrial Relaxation and Contraction, ER-Nucleus Signaling, Ribonucleoside Biosynthetic Process
-
