GAD65 antibody (N-Term)
-
- Target See all GAD65 (GAD2) Antibodies
- GAD65 (GAD2) (Glutamate Decarboxylase 2 (Pancreatic Islets and Brain, 65kDa) (GAD2))
-
Binding Specificity
- AA 131-164, N-Term
-
Reactivity
- Human, Rat, Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This GAD65 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Glutamate decarboxylase 2(GAD2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- KVIDFHYPNE LLQEYNWELA DQPQNLEEIL MHCQ
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Glutamate decarboxylase 2(GAD2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: glutamate decarboxylase 2 (pancreatic islets and brain, 65 kDa)
Protein Name: Glutamate decarboxylase 2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human GAD65 (131-164aa KVIDFHYPNELLQEYNWELADQPQNLEEILMHCQ), different from the related mouse and rat sequences by one amino acid.
- Isotype
- IgG
- Top Product
- Discover our top product GAD2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse, Rat, Predicted Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Mouse, Rat, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Predicted Species: Species predicted to be fit for the product based on sequence similarities. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Acrylamide neurotoxicity on the cerebrum of weaning rats." in: Neural regeneration research, Vol. 10, Issue 6, pp. 938-43, (2015) (PubMed).
: "
-
Acrylamide neurotoxicity on the cerebrum of weaning rats." in: Neural regeneration research, Vol. 10, Issue 6, pp. 938-43, (2015) (PubMed).
-
- Target
- GAD65 (GAD2) (Glutamate Decarboxylase 2 (Pancreatic Islets and Brain, 65kDa) (GAD2))
- Alternative Name
- GAD2 (GAD2 Products)
- Synonyms
- GAD65 antibody, gad65 antibody, F12P19.12 antibody, F12P19_12 antibody, GLUTAMATE DECARBOXYLASE 2 antibody, glutamate decarboxylase 2 antibody, zgc:112198 antibody, 6330404F12Rik antibody, GAD(65) antibody, Gad-2 antibody, glutamate decarboxylase 2 antibody, glutamate decarboxylase 1 antibody, glutamic acid decarboxylase 2 antibody, GAD2 antibody, PTRG_06148 antibody, LOC9324534 antibody, Gad2 antibody, GAD1 antibody, gad2 antibody
- Background
-
Glutamate decarboxylase 2, also known as GAD65, is an enzyme that in humans is encoded by the GAD2 gene. This gene encodes one of several forms of glutamic acid decarboxylase, identified as a major autoantigen in insulin-dependent diabetes. The enzyme encoded is responsible for catalyzing the production of gamma-aminobutyric acid from L-glutamic acid. A pathogenic role for this enzyme has been identified in the human pancreas since it has been identified as an autoantibody and an autoreactive T cell target in insulin-dependent diabetes. This gene may also play a role in the stiff man syndrome. Alternative splicing results in multiple transcript variants that encode the same protein.
Synonyms: 4.1.1.15 | 65 kDa glutamic acid decarboxylase | DCE 2 | DCE2 | GAD 2 | GAD 65 | GAD2 | GAD-2 | GAD65 | GAD-65 | Glutamate decarboxylase 2 | Glutamate Decarboxylase 65 | Q05329 - Gene ID
- 2572
- UniProt
- Q05329
-