You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human AGT antibody for Immunohistochemistry (Paraffin-embedded Sections)

Recommended AGT Antibody (supplied by: Log in to see )

Antigen
Angiotensinogen (serpin Peptidase Inhibitor, Clade A, Member 8) (AGT) Antibodies
  • Agat
  • AGT
  • AI265500
  • AI267024
  • Ang
  • AngI
  • AngII
  • angt
  • ANGT
  • ANHU
  • ANRT
  • Aogen
  • PAT
  • Serpina8
  • SERPINA8
  • Spat
  • SPT
  • wu:fb62f06
  • wu:fj87b02
  • zgc:111892
Reactivity
Human
200
63
59
7
2
2
1
1
1
1
Host
Rabbit
145
86
2
1
1
Clonality
Polyclonal
Conjugate
This AGT antibody is un-conjugated
16
12
4
4
3
3
2
2
2
2
2
2
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
127
107
56
38
21
19
12
12
6
4
3
3
2
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4352882
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0008919152 ABIN360211 EIA IHC (p) WB Rabbit Ig N-Term Log in to see Polyclonal 2
0.0008919152 ABIN392328 IHC (p) WB Rabbit Ig AA 418-450, C-Term Log in to see Polyclonal 1
0.0008919152 ABIN392327 IHC (p) WB Rabbit Ig AA 37-65, N-Term Log in to see Polyclonal 1
0.0008919152 ABIN447446 ICC IF IHC (p) IHC WB Rabbit N-Term, AA 1-50 Log in to see Polyclonal 6
0.0008919152 ABIN1048322 IHC (p) Rabbit Internal Region Log in to see Polyclonal
0.0008919152 ABIN1048321 IHC (p) Rabbit Internal Region Log in to see Polyclonal
0.0008919152 ABIN2855709 ICC IF IHC (p) WB Rabbit IgG Center Log in to see Polyclonal
0.0008919152 ABIN724115 IF (p) IHC (p) WB Mouse IgG Log in to see Polyclonal
0.0008919152 ABIN1997931 IHC (p) Rabbit IgG AA 1-485 Log in to see 34
0.0008919152 ABIN1731609 IHC (p) Rabbit IgG Internal Region Log in to see Polyclonal
0.0008919152 ABIN1731608 IHC (p) Rabbit IgG Internal Region Log in to see Polyclonal
0.0008919152 ABIN1857947 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG AA 35-485 Log in to see Polyclonal
0.0008919152 ABIN1857946 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG AA 155-355 Log in to see Polyclonal
0.0008919152 ABIN1833036 ICC IHC (p) WB Rabbit IgG AA 1-476 Log in to see Polyclonal
0.0008919152 ABIN513185 IHC (p) ELISA WB Mouse IgG3 kappa AA 1-485, full length Log in to see 3C10
0.0008919152 ABIN733270 IHC (p) WB Biotin Rabbit IgG Log in to see Polyclonal
0.0008919152 ABIN733277 IHC (p) WB HRP Rabbit IgG Log in to see Polyclonal
0.0008919152 ABIN1840326 IHC (p) WB Rabbit N-Term Log in to see Polyclonal
0.0008919152 ABIN733268 IF (p) IHC (p) WB Rabbit IgG Log in to see Polyclonal
0.0008919152 ABIN1840327 IHC (p) WB Rabbit C-Term Log in to see Polyclonal

Top referenced anti-AGT antibody for Immunohistochemistry (Paraffin-embedded Sections)

  • Human Polyclonal AGT Primary Antibody for ICC, IF - ABIN447446 (6 Publications): Dimitrijevic, Rissler, Luts, Edvinsson: Reduced expression of angiotensin II and angiotensin receptor type 1 and type 2 in resistance arteries from nasal lesions in granulomatosis with polyangiitis (Wegener's granulomatosis). in Scandinavian journal of rheumatology 2011 (PubMed)

  • Human Polyclonal AGT Primary Antibody for IHC, IHC (p) - ABIN4352882 (1 Publications): Bachmann, Burté, Pramana, Conte, Brown, Orimadegun, Ajetunmobi, Afolabi, Akinkunmi, Omokhodion, Akinbami, Shokunbi, Kampf, Pawitan, Uhlén, Sodeinde, Schwenk, Wahlgren, Fernandez-Reyes, Nilsson: Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria. in PLoS pathogens 2014 (PubMed)

  • Human Polyclonal AGT Primary Antibody for EIA, IHC (p) - ABIN360211 (2 Publications): Gürkan, Emingil, Saygan, Atilla, Köse, Baylas, Berdeli: Angiotensin-converting enzyme (ACE), angiotensinogen (AGT), and angiotensin II type 1 receptor (AT1R) gene polymorphisms in generalized aggressive periodontitis. in Archives of oral biology 2009 (PubMed)

Similar anti-AGT Antibodies

Application / Reactivity Human
ELISA 91 Antibodies
Enzyme Immunoassay (EIA) 11 Antibodies
Flow Cytometry (FACS) 4 Antibodies
Immunoassay (IA) 1 Antibodies
Immunochromatography (IC) 2 Antibodies
Immunocytochemistry (ICC) 17 Antibodies
Immunofluorescence (IF) 18 Antibodies
Immunofluorescence (Cultured Cells) (IF (cc)) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 12 Antibodies
Immunohistochemistry (IHC) 49 Antibodies
Immunohistochemistry (Formalin-fixed Paraffin-embedded Sections) (IHC (fp)) 1 Antibodies
Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) 1 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 3 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 36 Antibodies
Immunoprecipitation (IP) 3 Antibodies
Radioimmunoassay (RIA) 2 Antibodies
Western Blotting (WB) 110 Antibodies

General

Antigen Angiotensinogen (serpin Peptidase Inhibitor, Clade A, Member 8) (AGT) Antibodies
Reactivity Human
(200), (63), (59), (7), (2), (2), (1), (1), (1), (1)
Host Rabbit
(145), (86), (2), (1), (1)
Clonality
Polyclonal
Conjugate This AGT antibody is un-conjugated
(16), (12), (4), (4), (3), (3), (2), (2), (2), (2), (2), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(127), (107), (56), (38), (21), (19), (12), (12), (6), (4), (3), (3), (2), (1), (1), (1), (1)
Pubmed 1 reference available
Supplier Log in to see

Product Details anti-AGT Antibody

Target Details AGT Application Details Handling References for anti-AGT Antibody (ABIN4352882) Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:PKDPTFIPAPIQAKTSPVDEKALQDQLVLVAAKLDTEDKLRAAMVGMLANFLGFRIYGMHSELWGVVHGATVLSPTAVFGTLASLYLGALDHTADRLQAILGVPWKDKNCTSRLDAHKVLSALQAVQGLLVAQG
Isotype IgG

Target Details AGT

Product Details anti-AGT Antibody Application Details Handling References for anti-AGT Antibody (ABIN4352882) Images back to top
Antigen
Alternative Name Serpin A8/Angiotensinogen (AGT Antibody Abstract)
Background Gene Symbol: AGT
Molecular Weight Theoretical MW: 53 kDa
UniProt P01019
Pathways JAK-STAT Signaling, ACE Inhibitor Pathway, EGFR Signaling Pathway

Application Details

Product Details anti-AGT Antibody Target Details AGT Handling References for anti-AGT Antibody (ABIN4352882) Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-AGT Antibody Target Details AGT Application Details References for anti-AGT Antibody (ABIN4352882) Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

References for anti-AGT Antibody (ABIN4352882)

Product Details anti-AGT Antibody Target Details AGT Application Details Handling Images back to top
Product cited in:

Bachmann, Burté, Pramana, Conte, Brown, Orimadegun, Ajetunmobi, Afolabi, Akinkunmi, Omokhodion, Akinbami, Shokunbi, Kampf, Pawitan, Uhlén, Sodeinde, Schwenk, Wahlgren, Fernandez-Reyes, Nilsson: "Affinity proteomics reveals elevated muscle proteins in plasma of children with cerebral malaria." in: PLoS pathogens, Vol. 10, Issue 4, pp. e1004038, 2014

Images

Product Details anti-AGT Antibody Target Details AGT Application Details Handling References for anti-AGT Antibody (ABIN4352882) back to top
Supplier Images
Western Blotting (WB) image for anti-AGT antibody (Angiotensinogen (serpin Peptidase Inhibitor, Clade A, Member 8)) (ABIN4352882) Western Blot: Angiotensinogen Antibody [NBP1-87053] - Lane 1: Marker [kDa] 250, 130, ...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-AGT antibody (Angiotensinogen (serpin Peptidase Inhibitor, Clade A, Member 8)) (ABIN4352882) Immunohistochemistry-Paraffin: Angiotensinogen Antibody [NBP1-87053] - Staining of hu...