You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human CISH antibody for Immunohistochemistry

Recommended CISH Antibody (supplied by: Log in to see )

Antigen
Cytokine Inducible SH2-Containing Protein (CISH) Antibodies
  • AI385595
  • BACTS2
  • CIS
  • Cis
  • cis
  • CIS-1
  • cis-1
  • CIS1
  • cish
  • CISH
  • cish.a
  • F17
  • F23
  • g18
  • G18
  • ptk9l
  • SOCS
  • socs
  • twf1l
  • wu:fk57g04
  • zgc:91817
  • zgc:154062
Reactivity
Human
21
9
5
1
Host
Rabbit
22
2
Clonality
Polyclonal
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
23
5
5
4
3
2
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4298809
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0011390361 ABIN2233951 IC IHC WB Rabbit IgG C-Term Log in to see Polyclonal
0.0011390361 ABIN440988 DB ICC IF IHC (p) IHC WB Rabbit IgG Log in to see Polyclonal
0.0011390361 ABIN1980302 IHC WB Rabbit Log in to see Polyclonal
0.0011390361 ABIN2968904 IHC WB Rabbit IgG Log in to see Polyclonal

Similar anti-CISH Antibodies

Application / Reactivity Human
ELISA 2 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 7 Antibodies
Immunofluorescence (IF) 6 Antibodies
Immunohistochemistry (IHC) 5 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 7 Antibodies
Western Blotting (WB) 21 Antibodies

General

Antigen Cytokine Inducible SH2-Containing Protein (CISH) Antibodies
Reactivity Human
(21), (9), (5), (1)
Host Rabbit
(22), (2)
Clonality
Polyclonal
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
(23), (5), (5), (4), (3), (2), (1)
Supplier Log in to see

Product Details anti-CISH Antibody

Target Details CISH Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: APSLELPKPVMQPLPAGAFLEEVAEGTPAQTESEPKVLDPEEDLLCIAKTFSYLRESGWYWGSITASEARQHLQKMPEGTFLVRDSTHPSYLFTLSVKTTRGPTNVRIEYADSSFRLDSNCLSR

Target Details CISH

Product Details anti-CISH Antibody Application Details Handling Images back to top
Antigen
Alternative Name CISH/CIS-1 (CISH Antibody Abstract)
Background Gene Symbol: CISH
UniProt Q9NSE2
Pathways JAK-STAT Signaling

Application Details

Product Details anti-CISH Antibody Target Details CISH Handling Images back to top
Application Notes Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:20 - 1:50
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-CISH Antibody Target Details CISH Application Details Images back to top
Format Liquid
Buffer PBS and 40 % glycerol ( pH 7.2)
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-CISH Antibody Target Details CISH Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-CISH antibody (Cytokine Inducible SH2-Containing Protein) (ABIN4298809) Immunocytochemistry/Immunofluorescence: CISH/CIS-1 Antibody [NBP2-38474] - Immunofluo...
Immunohistochemistry (IHC) image for anti-CISH antibody (Cytokine Inducible SH2-Containing Protein) (ABIN4298809) Immunohistochemistry: CISH/CIS-1 Antibody [NBP2-38474] - Staining of human kidney sho...