You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human CNTF antibody for Immunocytochemistry

Recommended CNTF Antibody (supplied by: Log in to see )

Antigen
Ciliary Neurotrophic Factor (CNTF) Antibodies
  • CNTF
  • HCNTF
  • AI429687
  • GPA
  • ciliary neurotrophic factor
  • ciliary neurotrophic factor-like
  • ZFP91 zinc finger protein
  • CNTF
  • Cntf
  • LOC100885759
  • LOC100518821
  • ZFP91
Reactivity
Human
161
84
50
3
2
2
1
1
1
Host
Rabbit
184
17
10
3
3
Clonality
Polyclonal
Conjugate
This CNTF antibody is un-conjugated
34
14
9
3
3
3
2
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
174
130
44
20
14
13
12
9
8
7
5
5
4
3
3
1
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4299383
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1171995 ICC IHC (fro) IHC (p) ELISA WB Rabbit IgG Log in to see Polyclonal

Similar anti-CNTF Antibodies

Application / Reactivity Human
Blocking Antibody (Inhibition) 2 Antibodies
Blocking Peptide (BP) 1 Antibodies
Cellular Assay (CA) 1 Antibodies
Dot Blot (DB) 1 Antibodies
ELISA 87 Antibodies
Enzyme Immunoassay (EIA) 8 Antibodies
Functional Studies (Func) 3 Antibodies
Immunoassay (IA) 1 Antibodies
Immunochromatography (IC) 1 Antibodies
Immunocytochemistry (ICC) 2 Antibodies
Immunofluorescence (IF) 1 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 13 Antibodies
Immunohistochemistry (IHC) 31 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 4 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 15 Antibodies
Immunoprecipitation (IP) 6 Antibodies
Immunostaining (ISt) 1 Antibodies
Neutralization (Neut) 2 Antibodies

General

Antigen Ciliary Neurotrophic Factor (CNTF) Antibodies
Reactivity Human
(161), (84), (50), (3), (2), (2), (1), (1), (1)
Host Rabbit
(184), (17), (10), (3), (3)
Clonality
Polyclonal
Conjugate This CNTF antibody is un-conjugated
(34), (14), (9), (3), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(174), (130), (44), (20), (14), (13), (12), (9), (8), (7), (5), (5), (4), (3), (3), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-CNTF Antibody

Target Details CNTF Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:FHQAIHTLLLQVAAFAYQIEELMILLEYKIPRNEADGMPINVGDGGLFEKKLWGLKVLQELSQWTVRSIHDLRFISSHQTGIPARGSHYIANNK
Isotype IgG

Target Details CNTF

Product Details anti-CNTF Antibody Application Details Handling Images back to top
Antigen
Alternative Name CNTF (CNTF Antibody Abstract)
Background Gene Symbol: CNTF
Gene ID 1270
Research Area Stem Cells
Pathways JAK-STAT Signaling

Application Details

Product Details anti-CNTF Antibody Target Details CNTF Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:50 - 1:200For IHC-Paraffin HIER pH 6 retrieval is recommended. IF fixation permeabilization: PFA/Triton X-100.
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-CNTF Antibody Target Details CNTF Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-CNTF Antibody Target Details CNTF Application Details Handling back to top
Supplier Images
Western Blotting (WB) image for anti-CNTF antibody (Ciliary Neurotrophic Factor) (ABIN4299383) Western Blot: CNTF Antibody [NBP1-83277] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56,...
Immunofluorescence (IF) image for anti-CNTF antibody (Ciliary Neurotrophic Factor) (ABIN4299383) Immunocytochemistry/Immunofluorescence: CNTF Antibody [NBP1-83277] - Staining of huma...
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-CNTF antibody (Ciliary Neurotrophic Factor) (ABIN4299383) Immunohistochemistry-Paraffin: CNTF Antibody [NBP1-83277] - Staining of human cerebra...