anti-Human IL11RA antibody for Immunocytochemistry

Recommended IL11RA Antibody (supplied by: Log in to see )

Antigen
Interleukin 11 Receptor, alpha (IL11RA) Antibodies
  • fi26e06
  • il-11ra
  • wu:fi26e06
  • CRSDA
  • AI314697
  • GP130
  • Il-11ra
  • Il11ra
  • Il11ra2
  • NR1
  • interleukin 11 receptor, alpha
  • Interleukin-11 receptor subunit alpha-like
  • interleukin 11 receptor, alpha chain 1
  • il11ra
  • LOC556326
  • IL11RA
  • Il11ra1
Reactivity
Human
49
32
21
4
4
4
4
2
2
1
1
Host
Rabbit
57
7
Clonality
Polyclonal
Conjugate
This IL11RA antibody is un-conjugated
4
3
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
53
41
17
5
4
4
2
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

Submit your validation data for this product and get a full refund. I want to validate this product

Learn more

Available images

Catalog No. ABIN4325517
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
1 ABIN1176328 ICC IHC IP WB Rabbit IgG AA 59-220 Log in to see Polyclonal

General

Antigen Interleukin 11 Receptor, alpha (IL11RA) Antibodies
Reactivity Human
(49), (32), (21), (4), (4), (4), (4), (2), (2), (1), (1)
Host Rabbit
(57), (7)
Clonality
Polyclonal
Conjugate This IL11RA antibody is un-conjugated
(4), (3)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(53), (41), (17), (5), (4), (4), (2), (1), (1)
Supplier Log in to see

Product Details anti-IL11RA Antibody

Target Details IL11RA Application Details Handling Images
Purification Immunogen affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: LPHAVRVSARDFLDAGTWSTWSPEAWGTPSTGTIPKEIPAWGQLHTQPEVEPQVDSPAPPRPSLQPHPRLLDHRDS
Isotype IgG

Target Details IL11RA

Product Details anti-IL11RA Antibody Application Details Handling Images back to top
Antigen
Alternative Name IL11RA (IL11RA Antibody Abstract)
Background Gene Symbol: IL11RA
Gene ID 3590
Research Area Hematopoietic Progenitors, Cytokines, Innate Immunity, Cancer
Pathways JAK-STAT Signaling, Growth Factor Binding

Application Details

Product Details anti-IL11RA Antibody Target Details IL11RA Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL, Immunohistochemistry-Paraffin 1:200 - 1:500
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-IL11RA Antibody Target Details IL11RA Application Details Images back to top
Format Liquid
Buffer PBS ( pH 7.2) and 40 % Glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-IL11RA Antibody Target Details IL11RA Application Details Handling back to top
Supplier Images
Immunohistochemistry (IHC) image for anti-Interleukin 11 Receptor, alpha (IL11RA) antibody (ABIN4325517) Immunohistochemistry: IL11RA Antibody [NBP2-32671] - liver
Immunohistochemistry (IHC) image for anti-Interleukin 11 Receptor, alpha (IL11RA) antibody (ABIN4325517) Immunohistochemistry: IL11RA Antibody [NBP2-32671] - Immunohistochemical staining of ...
Immunohistochemistry (IHC) image for anti-Interleukin 11 Receptor, alpha (IL11RA) antibody (ABIN4325517) Immunohistochemistry: IL11RA Antibody [NBP2-32671] - pancreatic cancer
Western Blotting (WB) image for anti-Interleukin 11 Receptor, alpha (IL11RA) antibody (ABIN4325517) Western Blot: IL11RA Antibody [NBP2-32671] - Lane 1: Marker [kDa] 230, 130, 95, 72, 5...
Immunofluorescence (IF) image for anti-Interleukin 11 Receptor, alpha (IL11RA) antibody (ABIN4325517) Immunocytochemistry/Immunofluorescence: IL11RA Antibody [NBP2-32671] - Staining of hu...
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) image for anti-Interleukin 11 Receptor, alpha (IL11RA) antibody (ABIN4325517) Immunohistochemistry-Paraffin: IL11RA Antibody - Staining of human kidney shows stro...