You are viewing an incomplete version of our website. Please click to reload the website as full version.

anti-Human IL12B antibody for Immunofluorescence

Recommended IL12B Antibody (supplied by: Log in to see )

Antigen
Interleukin 12b (IL12B) Antibodies
  • CLMF
  • CLMF2
  • IL-12
  • IL-12.p40
  • IL-12B
  • Il-12b
  • IL-12p40
  • Il-12p40
  • Il12
  • IL12B
  • IL12p40
  • Il12p40
  • NKSF
  • NKSF2
  • p40
Reactivity
Human
148
60
27
23
20
6
2
2
1
1
Host
Rabbit
130
59
36
11
6
1
1
1
Clonality
Polyclonal
Conjugate
This IL12B antibody is un-conjugated
22
17
15
8
6
6
1
1
1
1
1
1
1
1
1
1
1
1
1
1
Application
Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
161
158
40
28
23
17
6
5
5
4
4
3
2
1
1
1
1
Supplier
Log in to see
Supplier Product No.
Log in to see
Request

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN4325520
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
0.0011012674 ABIN2419455 IF ELISA Rabbit IgG Log in to see Polyclonal

Similar anti-IL12B Antibodies

Application / Reactivity Human
Dot Blot (DB) 5 Antibodies
ELISA 100 Antibodies
ELISA (Capture) 1 Antibodies
ELISpot 1 Antibodies
Enzyme Immunoassay (EIA) 5 Antibodies
Flow Cytometry (FACS) 22 Antibodies
Functional Studies (Func) 3 Antibodies
Immunoassay (IA) 2 Antibodies
Immunocytochemistry (ICC) 1 Antibodies
Immunofluorescence (IF) 2 Antibodies
Immunohistochemistry (IHC) 38 Antibodies
Immunohistochemistry (Acetone-fixed) (IHC (af)) 1 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 22 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 11 Antibodies
Neutralization (Neut) 2 Antibodies
Western Blotting (WB) 94 Antibodies

General

Antigen Interleukin 12b (IL12B) Antibodies
Reactivity Human
(148), (60), (27), (23), (20), (6), (2), (2), (1), (1)
Host Rabbit
(130), (59), (36), (11), (6), (1), (1), (1)
Clonality
Polyclonal
Conjugate This IL12B antibody is un-conjugated
(22), (17), (15), (8), (6), (6), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF), Immunohistochemistry (IHC), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Western Blotting (WB)
(161), (158), (40), (28), (23), (17), (6), (5), (5), (4), (4), (3), (2), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-IL12B Antibody

Target Details IL12B Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Immunogen affinity purified
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids:NYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTS
Isotype IgG

Target Details IL12B

Product Details anti-IL12B Antibody Application Details Handling Images back to top
Antigen
Alternative Name IL12B (IL12B Antibody Abstract)
Background Gene Symbol: IL12B
Research Area Cytokines, Hormones
Pathways JAK-STAT Signaling

Application Details

Product Details anti-IL12B Antibody Target Details IL12B Handling Images back to top
Application Notes Western Blot 1:100 - 1:250, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1:10-1:500, Immunohistochemistry-Paraffin 1:20 - 1:50
Comment

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only

Handling

Product Details anti-IL12B Antibody Target Details IL12B Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

Images

Product Details anti-IL12B Antibody Target Details IL12B Application Details Handling back to top
Supplier Images
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) image for anti-IL12B antibody (Interleukin 12b) (ABIN4325520) Immunohistochemistry-Paraffin: IL12B Antibody [NBP1-84440] - Staining of human tonsil...
Western Blotting (WB) image for anti-IL12B antibody (Interleukin 12b) (ABIN4325520) Western Blot: IL12B Antibody [NBP1-84440] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55...