anti-Human IL15 antibody for Immunofluorescence

Recommended IL15 Antibody (supplied by: Log in to see )

Interleukin 15 (IL15) Antibodies
  • IL15
  • AI503618
  • IL-15
  • interleukin 15
  • IL15
  • Il15
This IL15 antibody is un-conjugated
Immunocytochemistry (ICC), Immunofluorescence (IF)
Log in to see
Supplier Product No.
Log in to see

Get this product for free

It's quick and easy to submit your validation proposal. I want to validate this product

Learn more

Available images

Catalog No. ABIN5077490
Contact our Customer Service for availability and price in your country.
Relevance Score ABIN Application Conjugate Host Isotype Epitope Supplier Clonality References Details
12.323053 ABIN517138 IF ELISA Mouse IgG1 kappa AA 49-162 Log in to see 1A5
12.323053 ABIN517140 IF ELISA WB Mouse IgG1 kappa AA 49-162 Log in to see 2F9
12.323053 ABIN517135 IF ELISA Mouse IgG1 kappa AA 49-162 Log in to see 3B9
12.323053 ABIN517128 IF ELISA Mouse IgG2a kappa AA 49-162 Log in to see 1H8
12.323053 ABIN517137 IF ELISA Mouse IgG1 kappa AA 49-162 Log in to see 3A4
1 ABIN5565742 FACS ICC IF IHC APC Rabbit AA 49-162 Log in to see Polyclonal
1 ABIN5565743 FACS ICC IF IHC FITC Rabbit AA 49-162 Log in to see Polyclonal
1 ABIN5565745 FACS ICC IF IHC PE Rabbit AA 49-162 Log in to see Polyclonal
1 ABIN2772608 IF ELISA Mouse IgG1, kappa Log in to see

Similar anti-IL15 Antibodies

Application / Reactivity Human
Blocking Antibody (Inhibition) 4 Antibodies
Blocking Peptide (BP) 1 Antibodies
Cell Culture (CC) 1 Antibodies
Cellular Assay (CA) 1 Antibodies
Dot Blot (DB) 4 Antibodies
ELISA 143 Antibodies
ELISA (Detection) 1 Antibodies
Enzyme Immunoassay (EIA) 7 Antibodies
Flow Cytometry (FACS) 30 Antibodies
Functional Studies (Func) 8 Antibodies
Immunoassay (IA) 3 Antibodies
Immunocytochemistry (ICC) 7 Antibodies
Immunofluorescence (IF) 10 Antibodies
Immunofluorescence (fixed cells) (IF/ICC) 1 Antibodies
Immunofluorescence (Paraffin-embedded Sections) (IF (p)) 1 Antibodies
Immunohistochemistry (IHC) 49 Antibodies
Immunohistochemistry (Frozen Sections) (IHC (fro)) 1 Antibodies
Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) 30 Antibodies
Immunoprecipitation (IP) 24 Antibodies
Immunostaining (ISt) 1 Antibodies


Antigen Interleukin 15 (IL15) Antibodies
Reactivity Human
(226), (66), (24), (10), (8), (6), (5), (2), (2), (1), (1), (1)
Host Rabbit
(143), (123), (17), (17), (5), (5)
Conjugate This IL15 antibody is un-conjugated
(36), (17), (11), (9), (7), (5), (5), (5), (5), (5), (4), (3), (3), (3), (3), (3), (3), (3), (2), (2), (2), (2), (1), (1)
Application Immunocytochemistry (ICC), Immunofluorescence (IF)
(203), (182), (66), (34), (31), (29), (25), (15), (12), (11), (10), (7), (5), (4), (3), (3), (2), (1), (1), (1), (1), (1), (1), (1), (1)
Supplier Log in to see

Product Details anti-IL15 Antibody

Target Details IL15 Application Details Handling Images
Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Purification Affinity purified
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Isotype IgG

Target Details IL15

Product Details anti-IL15 Antibody Application Details Handling Images back to top
Alternative Name IL-15 (IL15 Antibody Abstract)
Background Gene Symbol: IL15
Gene ID 3600
Research Area Immunology, Cytokines, Inflammation, Virology, Cancer
Pathways JAK-STAT Signaling, Glycosaminoglycan Metabolic Process

Application Details

Product Details anti-IL15 Antibody Target Details IL15 Handling Images back to top
Application Notes Immunocytochemistry/Immunofluorescence 1-4 μg/mLImmunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

The antibodies are intended for use in vitro experiments only. Our antibodies have not been tested nor are recommended for use in vivo.

Restrictions For Research Use only


Product Details anti-IL15 Antibody Target Details IL15 Application Details Images back to top
Format Liquid
Buffer PBS, pH 7.2, containing 40 % glycerol
Buffer contains: 0.02 % Sodium Azide
Preservative Sodium azide
Precaution of Use This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
Storage 4 °C,-20 °C
Storage Comment Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.


Product Details anti-IL15 Antibody Target Details IL15 Application Details Handling back to top
Supplier Images
Immunofluorescence (IF) image for anti-IL15 antibody (Interleukin 15) (ABIN5077490) Immunocytochemistry/Immunofluorescence: IL-15 Antibody - Staining of human cell line...